KEGG   Heterocephalus glaber (naked mole rat): 101723321Help
Entry
101723321         CDS       T02812                                 

Gene name
Art1
Definition
ADP-ribosyltransferase 1
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101723321 (Art1)
Cellular antigens [BR:hgl04090]
 Proteins
  101723321 (Art1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 325 aa AA seqDB search
MQVPAMLSLLLVSVGLSDALQVQRHSITRRDIFPQETLLDMALASFDDQYSGCAAAMTAA
LPELNHTEFQANKVYAEGWALASSQWQEHQAWEPEWGLSTTRPPPPPPGFRDEHGVALLA
YTANSPLHKEFNAAVREAGRSRAQYLQHFSFKTLHFLLTEALQLLGTGQRPPRCHQVYRG
VHGLRFRPVGPGATVRLGGFTSASLKNVAAQQFGEDTFFGIWTCLGAPIRGYSFFPGEEE
VLIPPFETFQVINASRPAQGPAHIYLRALGKRSMYNCEYIKDKKCKSGPCRLDGSATCQG
SLFTVWSLLLLLWFLEALPASPDLL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttcctgccatgctgtctctgctacttgtgtctgtgggcctctcagatgccctt
caggtgcagaggcactccatcacacgacgagacattttccctcaagaaaccctcctggac
atggccctggcctccttcgatgaccagtactcaggctgtgcggcagccatgacagctgcc
ctcccagaactcaaccacacggagttccaggccaacaaagtctatgcagagggctgggca
ctggccagcagccagtggcaggagcaccaggcctgggagccagagtggggcttgagcact
acccggccgccaccgccaccccccggcttccgggatgagcatggggtggcgctcctggcc
tacactgccaacagccctctgcacaaggagttcaatgccgctgtgcgagaggccggccgc
tcccgggcccagtacctccagcacttctccttcaagacgctccatttcctgctcacagag
gccctgcagctgctggggacaggccaacgtccgccccggtgccaccaggtgtaccgaggg
gtgcacggcctgcgtttccggcctgtagggcctggggccacagtaaggctggggggcttc
acctctgcgtccctgaagaatgtcgcagcccagcagtttggagaggacaccttctttggc
atctggacctgcttaggggctcctatcagaggttactccttcttccctggagaggaggag
gtgctgatccctccctttgagaccttccaggtgatcaatgccagccgaccagcccagggg
cctgcccacatctacctccgggccctgggcaagcgcagcatgtacaactgtgagtacatc
aaagacaagaagtgcaagtctgggccctgccgtctggatggctcagccacgtgtcagggc
tccctcttcacagtctggtccctgctgctgttgctgtggttcctggaggcccttccagca
agtccagacctgctctga

DBGET integrated database retrieval system