KEGG   Heterocephalus glaber (naked mole rat): 101724312Help
Entry
101724312         CDS       T02812                                 

Gene name
Dbh
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    101724312 (Dbh)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     101724312 (Dbh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 620 aa AA seqDB search
MQDPSCQHRGPGLPSPSVREAASMYGTAVAIFLVILVAALQGSAPPENPFPYHILLDPQG
TLELSWNVSYIQETVHFRLLVRGLKAGLLFGMSDRGELENADLVVLWTNGDSAYFADAWS
DWKGQIHLDTQQDYQLLQAQGTPDGLSLLFKRPFGTCDPKDYFIQDDTVHLVYGILEQPF
SSLEAINTSGLQTGLQRVQLLKPELPVPTMPADTRTMEIRAPDVLIPAQETTYWCYISEL
PQGFPRHHIVMYEPLVTQGNEALVHHMEIFQCAGAFESFPHFSGPCDSRMKPERLNHCRH
VLAAWALGAKAFYYPQEAGLPFGGKGSSRFLRLEVHYHNPLKIQGRRDSSGIRLYYTATL
RHFDAGILELGLVYTPLMAIPPREAAFVLTGYCTDKCTQLALPPTGIHIFASQLHTHLTG
RKVVTVLARDGRELEVVSRDNHYSPHFQEIRMLKKAVSVLPGDVLITSCTYNTEDRKLAT
VGGFGILEEMCVNYVHYYPQTQLELCKSTVDAGFLQKYFHLVNRFNSEEVCTCPQASVPE
QFASVPWNSFSRDVLAALYGSAPISMHCNKSSAIRFQGEWDLQPLPEMVSTLEEPTPQCP
PSLVQHPAGPTVVSLSRGRG
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaccccagctgccagcatcgtgggcctggcctccccagccccagcgtgcgtgag
gcagcttccatgtatggcacggcagtggccatcttcttggtcatcctggtggccgcactg
cagggctcggcgcctcccgagaaccccttcccctaccacatcctcctggacccccagggc
actctggagctctcctggaacgtcagttacatccaggagactgtccacttccgcctcctc
gtgcgcgggctcaaggccggactcctgttcgggatgtcagaccgcggtgagctggagaat
gctgacctcgttgtgctctggaccaatggcgacagcgcctactttgccgatgcctggagt
gactggaaggggcagatccacctggacacccagcaggactaccagttgctgcaggcccag
ggcacaccggacggcctgtccctgctcttcaagaggccctttggcacctgtgaccccaag
gactacttcatccaggacgacactgtccacttggtgtatgggatcctggagcagccgttc
tcttcgctggaggccatcaacacctcgggcctgcagacggggctgcagcgggtgcagctg
ctgaagcccgagctcccggtgccaacgatgcctgcggacactcgcaccatggagatccga
gcccctgacgtcctgatacccgcccaggagaccacgtactggtgctacatctctgagctt
ccccagggcttcccccggcaccacatcgtcatgtatgagcccctcgtcacccagggcaac
gaggccctggtgcaccacatggaaatcttccagtgcgcgggtgccttcgagagcttccca
cacttcagcgggccctgcgactccaggatgaagccggaacgcctcaaccactgccgccac
gtgctggccgcctgggcgctgggcgccaaggcattctactacccacaggaggcgggtctc
ccttttgggggcaaggggtcctcccggttcctccgcctggaagtccactaccacaacccc
ttgaagatccaaggccggcgtgactcctcaggcatccgcctgtactacacggccacgctg
cggcacttcgacgcgggcatcctggagctgggcctggtgtacacacccctgatggccatc
ccgccgcgggaggccgccttcgtcctcaccggctactgcaccgacaagtgcacccagctg
gccctgccgcccactgggatccacatctttgcctctcagctccacacgcacttgactggg
aggaaggtggtcaccgtgctggcccgggacggccgggagctggaggtcgtgagcagggac
aaccactatagtccacacttccaggagatccgcatgttgaagaaggctgtgtccgtcctc
ccaggagatgttctcatcacttcctgcacatacaacacggaagacaggaagctggccact
gtggggggcttcgggatcctggaggagatgtgcgtcaactacgtgcactactaccctcag
acgcagctggagctctgcaaaagcactgtggacgccggcttcctgcagaagtatttccac
ctggtgaacaggttcaacagtgaggaggtgtgcacctgcccacaggcctctgtgccagag
cagttcgcctcagtgccctggaactccttcagccgtgatgtgctggccgccctgtacggc
tccgcccccatctccatgcactgcaacaagtcctcggccatccgcttccagggtgagtgg
gatctgcagcccctgcctgagatggtctccaccctggaagagcccaccccacagtgccca
cccagcctggtgcagcaccctgccggccccaccgtggtcagcctcagccgcggaagaggc
tga

DBGET integrated database retrieval system