KEGG   Heterocephalus glaber (naked mole rat): 101724847Help
Entry
101724847         CDS       T02812                                 

Gene name
Kat2a
Definition
K(lysine) acetyltransferase 2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101724847 (Kat2a)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101724847 (Kat2a)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101724847 (Kat2a)
  Infectious diseases
   05166 HTLV-I infection
    101724847 (Kat2a)
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101724847 (Kat2a)
Transcription machinery [BR:hgl03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101724847 (Kat2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 762 aa AA seqDB search
PARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKCNGWKNPKPPTAPRMD
LQQPAANLGELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTK
QVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMF
ELSKMFLLCLNYWKLETPAQFRQRSQSEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTH
VFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIW
ESGFTMPPSEGAQLVPRPATVSAAVVPSTPIFSSSMGGGSNSSLSLDATGAEPMPGEKRK
LPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEER
RGIIEFHVIGNSLAPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIK
DGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHGILYFLTYAD
EYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEII
KKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYT
TLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTDRLRSRYYVTRKLFVA
DLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
cccgcgcggcccgggctcagccagcagcagcgcgccagccagcgcaaggcgcaggtccgc
ggcctgcctcgcgcgaagaagctggagaagctgggcgtcttctcggcctgcaaggccaac
gagacctgcaagtgcaatggctggaagaaccccaagccgcccaccgcgccccgcatggac
ctgcagcagccagctgctaacctgggcgagctgtgccgcagctgcgagcaccccctggct
gaccacgtgtctcacctggagaacgtgtcggaggacgagatcaaccggctgctgggcatg
gtggtggacgtggagaacctgttcatgtcggtgcacaaggaggaggatacggacaccaag
caggtgtatttctacctcttcaagctcctgcggaaatgcatcttgcagatgacccggccc
gtggtggaagggtccctgggcagccccccattcgagaagcctaacattgagcagggtgtg
cttaactttgtgcagtacaagttcagtcacctggcaccccgggagcggcagactatgttt
gagctctctaagatgtttctgctctgtctcaactactggaagctggagacgcctgctcag
ttccggcagaggtcccagtccgaggacgtggccacctacaaggtcaactacaccaggtgg
ctctgttactgccacgtgccccaaagctgtgacagcctccctcgctacgagaccacccat
gtattcgggcgcagcctgctgcggtccattttcactgtgactcgccggcagctgctggaa
aagttccgagtggagaaggacaagctggtgcctgagaagaggacgctcatcctcacccac
ttccccaagttcctgtccatgctcgaggaggagatctatggggccaactctcccatctgg
gagtcgggcttcaccatgccaccctcggagggggcgcagctggtgccccggccagccacg
gtcagtgccgcggtggttcccagcaccccgatcttcagctccagcatgggaggcggcagc
aacagctccctgagtctggatgccacgggggcggagcccatgccaggcgaaaagaggaag
ctgcccgagaacctgaccctggaggatgccaagcggctgcgcgtgatgggcgacatcccc
atggagctggtcaacgaggtcatgctgaccatcaccgaccccgccgccatgctgggcccc
gagaccagcttgctgtcggccaatgccgcgcgcgacgagaccgcccgcctggaggagcgg
cgtggcatcatcgagttccacgtcatcggcaactcgctcgcacccaaggccaaccggcgg
gtgctgctctggttggtggggctgcagaacgtcttctcgcaccagctgccgcgcatgccc
aaggagtacatcgcccgcctcgttttcgacccgaagcacaagacgctggccctgatcaag
gacgggcgcgtcatcggcggcatctgcttccgtatgttccccacccagggcttcaccgaa
atcgtgttctgcgctgtcacctccaatgagcaggtcaagggctacggcacccacctgatg
aaccacctgaaggagtaccacatcaagcacggcatcctctacttcctcacctacgccgac
gagtacgccatcggctacttcaagaagcagggcttctccaaggacatcaaggtccccaag
agccgctacctaggctacatcaaggactacgagggggcgacgctgatggagtgcgagctg
aacccccgaatcccgtacacagagctgtcacacatcatcaagaagcagaaagagatcatc
aagaagctgattgagcgcaaacaggcccagatccgcaaggtctaccctgggctcagctgc
ttcaaggagggtgtgcggcagatccccgtggagagcgtgcccggcatccgagagacgggc
tggaagccactggggaaggagaagggcaaggagctcaaggaccccgaccagctgtacacg
accctcaagaacctgctggcccagatcaagtcgcaccccagcgcctggcccttcatggag
ccggtgaagaagtcggaggcccccgactactacgaggtcatccgcttccccatcgacctg
aagaccatgacggaccggctgcgcagccgctattacgtgacccgcaagctcttcgtggcc
gacctgcagcgggtcatcgccaactgccgcgagtacaacccgccggacagcgagtactgc
cgctgcgccagtgcgctggagaagttcttctacttcaagctcaaggagggcgggctcatc
gacaagtag

DBGET integrated database retrieval system