KEGG   Heterocephalus glaber (naked mole rat): 101724983Help
Entry
101724983         CDS       T02812                                 

Gene name
Ces3
Definition
(RefSeq) carboxylesterase 3
  KO
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     101724983 (Ces3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 580 aa AA seqDB search
MLLPTVSCEEHGRIVSKAGSDVLVWVACLLLAFPATATEPQTAQPEVDTRLGCVQGQQVG
VKGTDRLVNVFLGIPFAQPPLGPLRFTPPLPAQPWEGVRDAGTDPSMCMQHIERMNNTRF
WLNGKHKIFPISEDCLILNIYSPAKATTKARKPVMVRIHGGXVVIGSASSQDGSALAAYE
GVVVVTVQYHLGIFGFFSTGDKHVPGNQAFLDVVAALCWVQENITPFRGDPNCVSIIGGS
AGGSIVSALVLSPMAMGLFHRTIAQSGVIFAPLLRGSDLWLKAQSLADSLACSSDSPAEL
VQCLQQKKGEELIPTKKMIVSTYTIDGSFFPKSPEELLKERQFHPVPFLIGVNSHEFGWL
IPRAWGMLDKMEQMNQEYMLDVFKPCLASLNVPPEMMSMVIDQYIGSGSDAQPRREDFQE
LAGNIFFNIPALNFSRHLQDSGAPVFFYEFQHVPSSFVKIKPPWVKADHVAEIVFMFGGP
FLMDENTLLAFPEATEEEKQLSLTMMAQWAHFARTGDPNGEGLPLWPRFNQWEXYLEISL
VPQIRQKLKKAQMQFWTETLPSKIQQWHQQKQGRKAPEEL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcttctccccacagtcagttgtgaggaacatggaaggatagtgtctaaagctgggtct
gatgtcctggtctgggtagcctgtctgctcttggcatttcctgccacagccactgagccc
caaaccgctcagcctgaagtggacacccgcctgggctgtgtgcaaggccagcaggtgggc
gtgaaggggacagaccgccttgtgaatgtcttcctgggcatcccatttgcacagccaccc
ctggggcctctcaggttcactcccccactgccagcacagccctgggaaggtgtacgggat
gctggcactgacccctcaatgtgcatgcagcacatagaaagaatgaacaataccagattc
tggctcaatggaaaacacaaaatcttccctatttctgaggactgcctcatcctaaacatc
tacagcccagctaaggccactacaaaggccaggaagccagtcatggtacggatccatgga
ggtntcgtggtgattggctctgcctcctcccaggatggatcagccctggctgcctatgag
ggtgtggtagtggtcacagttcaataccaccttgggatctttggcttctttagcactggg
gacaagcatgtgcctggcaaccaggccttcctagatgtggtggctgctctatgctgggtg
caggagaacatcactcccttcaggggtgatcccaactgtgtcagcatcattggcggatct
gcaggtggcagcattgtctctgccctggtgctgtctccaatggccatgggactgttccac
agaaccattgcacagagtggagtcatctttgccccactgttaagaggatctgacttatgg
ctcaaagctcagagccttgcagactccttggcctgcagctctgactccccagctgagctg
gtacagtgccttcagcagaagaaaggagaggagctgatccctaccaaaaaaatgatagtc
tcgacctacaccatagatggctctttctttcccaaaagccctgaggagctcctgaaggaa
aggcagttccaccctgtgcccttcctcataggtgtcaacagtcatgagtttggatggctc
atccccagggcctggggtatgctggataagatggagcagatgaaccaggaatacatgctg
gatgtcttcaagccctgcttggccagtctgaacgtgccccctgagatgatgtccatggtc
atagaccagtatataggcagtggctcagatgcacaacccagacgtgaagacttccaggaa
ctggctggcaatatcttcttcaacatccctgctttgaatttctcaagacacctccaagat
tctggggcccccgtttttttctatgagttccagcatgtacctagctcttttgtaaagatc
aagccaccctgggtgaaggctgaccatgtggctgagatcgtattcatgtttgggggtcct
ttcctcatggatgaaaacaccctcctggcctttccagaggccacagaggaggagaagcag
ctgagcctcaccatgatggcccagtgggcccactttgcccgaacaggggaccccaatggc
gaagggctgcctctttggccccgattcaaccagtgggagtaatacttggagatcagcctc
gtgccacagatcaggcagaagctgaagaaggcccagatgcagttctggacagagacactc
cccagcaagatccaacagtggcatcaacagaagcaaggcaggaaggccccagaggagctc
tga

DBGET integrated database retrieval system