KEGG   Heterocephalus glaber (naked mole rat): 101725004Help
Entry
101725004         CDS       T02812                                 

Definition
(RefSeq) josephin-2
  KO
K06989  aspartate dehydrogenase [EC:1.4.1.21]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00760  Nicotinate and nicotinamide metabolism
hgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    101725004
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.21  aspartate dehydrogenase
     101725004
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Josephin DUF108 NAD_binding_3
Motif
Other DBs
NCBI-GeneID: 101725004
NCBI-ProteinID: XP_004866864
Position
Un
AA seq 483 aa AA seqDB search
MSKEQQLRSLRGALSRQGGPAAEHKTQGHGPCWGPAEGQSLVSRLLAQGSELGLELVFVW
NRDPGRMAGSVPPSLQLHSLTALGERHPDLVVEVAHPKIIQESGAHILRHANLLVGSPSA
LADQTTQQQLLAASHHWGHAMFVARGALWGTEDISRLDAAGGLQSLRVTMATHPDGFRLE
GPLATTHSTGPRTVLYEGPVRGLCPFAPRNSNTMAAAALAAPSLGFDNVIGVLVADLSLA
DMHVVDVELRGPPGPTGRNFAVHTHRENPAEPGAVTGSATVAAFWRSLLAGAEGSMSQAP
GARPSPPSVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGT
GNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRH
WVALRQVDGIYYNLDSKLRAPEALGDEDGVRAFVAAALARGLCEVLLVVTKEVEEKGCWL
QTD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagagcagcagctacgcagcctgcgtggggcactgagcaggcagggaggccca
gccgcagaacacaagacccaagggcatggcccctgctggggtccggcggaaggacagtcc
ctcgtctcccgccttctggctcagggatctgaactgggccttgaacttgtatttgtctgg
aaccgagacccaggccgcatggcagggagcgtgcccccgtccctgcagctccacagcctc
actgcccttggggaaaggcaccctgatctggtggtagaagtggcccatcccaaaataatc
caggaatctggggcacacatcctgcgccatgccaacctcctggtggggtccccatcagcc
ctggctgaccagaccacacagcagcagctccttgccgcctcccaccactggggccacgcc
atgtttgtggctcgaggagcactgtgggggactgaggacatctcgagattggatgcagcc
ggaggcctccagagccttcgagtcaccatggccacacacccagatggcttccggctagag
ggacccctagctaccactcacagcactgggcctcgcactgtgctctacgaaggccctgtc
cgtgggctctgcccctttgctccccgaaactccaacaccatggcagctgctgccctggct
gcccccagcctaggctttgacaacgtgatcggggtgcttgtggcggatctcagcctcgcg
gacatgcacgtggtggacgtggagctgagaggacccccggggcccacgggccggaatttc
gctgtgcacacccaccgggagaacccagcggagccaggcgctgtcaccggctccgccact
gttgctgccttctggcgcagcctcctggcaggagccgagggcagcatgtcccaggcccca
ggagcacggccgagcccaccctccgtgtaccacgagcggcagcgcctggagctgtgtgcc
gtccacgccctcaacaacgttctgcagcagcagctctttagccaggaggctgccgatgag
atctgcaagaggctggcccccgactcccggctgaacccccaccgcagcctcctgggtacc
ggcaactatgacgtcaacgtgatcatggcggccctgcaggggctgggcctggccgctgta
tggtgggaccgcaggaggcccctgtcccagctggccctgccccaggtgctggggctgatc
ctgaacctgccctcgcccgtgtcgctggggctgctgtccctgccactgcgccggcggcac
tgggtggccctgcgccaggtggacggcatctactacaacctcgactccaaactgcgggcg
ccggaggcccttggggacgaggatggtgtcagggcctttgtggcggccgccctggcccga
gggctgtgtgaggtgctgctggtggtgaccaaggaggtggaggagaagggctgctggctg
cagacagactga

DBGET integrated database retrieval system