KEGG   Heterocephalus glaber (naked mole rat): 101725004Help
Entry
101725004         CDS       T02812                                 

Definition
(RefSeq) josephin-2
  KO
K15235  
josephin [EC:3.4.19.12]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101725004
Peptidases [BR:hgl01002]
 Cysteine Peptidases
  Family C86
   101725004
Ubiquitin system [BR:hgl04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    101725004
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 483 aa AA seqDB search
MSKEQQLRSLRGALSRQGGPAAEHKTQGHGPCWGPAEGQSLVSRLLAQGSELGLELVFVW
NRDPGRMAGSVPPSLQLHSLTALGERHPDLVVEVAHPKIIQESGAHILRHANLLVGSPSA
LADQTTQQQLLAASHHWGHAMFVARGALWGTEDISRLDAAGGLQSLRVTMATHPDGFRLE
GPLATTHSTGPRTVLYEGPVRGLCPFAPRNSNTMAAAALAAPSLGFDNVIGVLVADLSLA
DMHVVDVELRGPPGPTGRNFAVHTHRENPAEPGAVTGSATVAAFWRSLLAGAEGSMSQAP
GARPSPPSVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGT
GNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRH
WVALRQVDGIYYNLDSKLRAPEALGDEDGVRAFVAAALARGLCEVLLVVTKEVEEKGCWL
QTD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagagcagcagctacgcagcctgcgtggggcactgagcaggcagggaggccca
gccgcagaacacaagacccaagggcatggcccctgctggggtccggcggaaggacagtcc
ctcgtctcccgccttctggctcagggatctgaactgggccttgaacttgtatttgtctgg
aaccgagacccaggccgcatggcagggagcgtgcccccgtccctgcagctccacagcctc
actgcccttggggaaaggcaccctgatctggtggtagaagtggcccatcccaaaataatc
caggaatctggggcacacatcctgcgccatgccaacctcctggtggggtccccatcagcc
ctggctgaccagaccacacagcagcagctccttgccgcctcccaccactggggccacgcc
atgtttgtggctcgaggagcactgtgggggactgaggacatctcgagattggatgcagcc
ggaggcctccagagccttcgagtcaccatggccacacacccagatggcttccggctagag
ggacccctagctaccactcacagcactgggcctcgcactgtgctctacgaaggccctgtc
cgtgggctctgcccctttgctccccgaaactccaacaccatggcagctgctgccctggct
gcccccagcctaggctttgacaacgtgatcggggtgcttgtggcggatctcagcctcgcg
gacatgcacgtggtggacgtggagctgagaggacccccggggcccacgggccggaatttc
gctgtgcacacccaccgggagaacccagcggagccaggcgctgtcaccggctccgccact
gttgctgccttctggcgcagcctcctggcaggagccgagggcagcatgtcccaggcccca
ggagcacggccgagcccaccctccgtgtaccacgagcggcagcgcctggagctgtgtgcc
gtccacgccctcaacaacgttctgcagcagcagctctttagccaggaggctgccgatgag
atctgcaagaggctggcccccgactcccggctgaacccccaccgcagcctcctgggtacc
ggcaactatgacgtcaacgtgatcatggcggccctgcaggggctgggcctggccgctgta
tggtgggaccgcaggaggcccctgtcccagctggccctgccccaggtgctggggctgatc
ctgaacctgccctcgcccgtgtcgctggggctgctgtccctgccactgcgccggcggcac
tgggtggccctgcgccaggtggacggcatctactacaacctcgactccaaactgcgggcg
ccggaggcccttggggacgaggatggtgtcagggcctttgtggcggccgccctggcccga
gggctgtgtgaggtgctgctggtggtgaccaaggaggtggaggagaagggctgctggctg
cagacagactga

DBGET integrated database retrieval system