KEGG   Heterocephalus glaber (naked mole rat): 101725004Help
Entry
101725004         CDS       T02812                                 

Gene name
Josephin-2
Definition
josephin-2-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 513 aa AA seqDB search
MPCPGAPSADPLPISGHWGHQGGSGRAKGQMSKEQQLRSLRGALSRQGGPAAEHKTQGHG
PCWGPAEGQSLVSRLLAQGSELGLELVFVWNRDPGRMAGSVPPSLQLHSLTALGERHPDL
VVEVAHPKIIQESGAHILRHANLLVGSPSALADQTTQQQLLAASHHWGHAMFVARGALWG
TEDISRLDAAGGLQSLRVTMATHPDGFRLEGPLATTHSTGPRTVLYEGPVRGLCPFAPRN
SNTMAAAALAAPSLGFDNVIGVLVADLSLADMHVVDVELRGPPGPTGRNFAVHTHRENPA
EPGAVTGSATVAAFWRSLLAGAEGSMSQAPGARPSPPSVYHERQRLELCAVHALNNVLQQ
QLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQ
LALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGIYYNLDSKLRAPEALGDEDGV
RAFVAAALARGLCEVLLVVTKEVEEKGCWLQTD
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgccctgcccaggggcgccctctgcagacccactgcccatctctggccactgggggcac
cagggaggttcaggcagggccaagggtcaaatgtccaaagagcagcagctacgcagcctg
cgtggggcactgagcaggcagggaggcccagccgcagaacacaagacccaagggcatggc
ccctgctggggtccggcggaaggacagtccctcgtctcccgccttctggctcagggatct
gaactgggccttgaacttgtatttgtctggaaccgagacccaggccgcatggcagggagc
gtgcccccgtccctgcagctccacagcctcactgcccttggggaaaggcaccctgatctg
gtggtagaagtggcccatcccaaaataatccaggaatctggggcacacatcctgcgccat
gccaacctcctggtggggtccccatcagccctggctgaccagaccacacagcagcagctc
cttgccgcctcccaccactggggccacgccatgtttgtggctcgaggagcactgtggggg
actgaggacatctcgagattggatgcagccggaggcctccagagccttcgagtcaccatg
gccacacacccagatggcttccggctagagggacccctagctaccactcacagcactggg
cctcgcactgtgctctacgaaggccctgtccgtgggctctgcccctttgctccccgaaac
tccaacaccatggcagctgctgccctggctgcccccagcctaggctttgacaacgtgatc
ggggtgcttgtggcggatctcagcctcgcggacatgcacgtggtggacgtggagctgaga
ggacccccggggcccacgggccggaatttcgctgtgcacacccaccgggagaacccagcg
gagccaggcgctgtcaccggctccgccactgttgctgccttctggcgcagcctcctggca
ggagccgagggcagcatgtcccaggccccaggagcacggccgagcccaccctccgtgtac
cacgagcggcagcgcctggagctgtgtgccgtccacgccctcaacaacgttctgcagcag
cagctctttagccaggaggctgccgatgagatctgcaagaggctggcccccgactcccgg
ctgaacccccaccgcagcctcctgggtaccggcaactatgacgtcaacgtgatcatggcg
gccctgcaggggctgggcctggccgctgtatggtgggaccgcaggaggcccctgtcccag
ctggccctgccccaggtgctggggctgatcctgaacctgccctcgcccgtgtcgctgggg
ctgctgtccctgccactgcgccggcggcactgggtggccctgcgccaggtggacggcatc
tactacaacctcgactccaaactgcgggcgccggaggcccttggggacgaggatggtgtc
agggcctttgtggcggccgccctggcccgagggctgtgtgaggtgctgctggtggtgacc
aaggaggtggaggagaagggctgctggctgcagacagactga

DBGET integrated database retrieval system