KEGG   Heterocephalus glaber (naked mole rat): 101725004Help
Entry
101725004         CDS       T02812                                 

Definition
(RefSeq) josephin-2
Organism
hgl  Heterocephalus glaber (naked mole rat)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 483 aa AA seqDB search
MSKEQQLRSLRGALSRQGGPAAEHKTQGHGPCWGPAEGQSLVSRLLAQGSELGLELVFVW
NRDPGRMAGSVPPSLQLHSLTALGERHPDLVVEVAHPKIIQESGAHILRHANLLVGSPSA
LADQTTQQQLLAASHHWGHAMFVARGALWGTEDISRLDAAGGLQSLRVTMATHPDGFRLE
GPLATTHSTGPRTVLYEGPVRGLCPFAPRNSNTMAAAALAAPSLGFDNVIGVLVADLSLA
DMHVVDVELRGPPGPTGRNFAVHTHRENPAEPGAVTGSATVAAFWRSLLAGAEGSMSQAP
GARPSPPSVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGT
GNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRH
WVALRQVDGIYYNLDSKLRAPEALGDEDGVRAFVAAALARGLCEVLLVVTKEVEEKGCWL
QTD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagagcagcagctacgcagcctgcgtggggcactgagcaggcagggaggccca
gccgcagaacacaagacccaagggcatggcccctgctggggtccggcggaaggacagtcc
ctcgtctcccgccttctggctcagggatctgaactgggccttgaacttgtatttgtctgg
aaccgagacccaggccgcatggcagggagcgtgcccccgtccctgcagctccacagcctc
actgcccttggggaaaggcaccctgatctggtggtagaagtggcccatcccaaaataatc
caggaatctggggcacacatcctgcgccatgccaacctcctggtggggtccccatcagcc
ctggctgaccagaccacacagcagcagctccttgccgcctcccaccactggggccacgcc
atgtttgtggctcgaggagcactgtgggggactgaggacatctcgagattggatgcagcc
ggaggcctccagagccttcgagtcaccatggccacacacccagatggcttccggctagag
ggacccctagctaccactcacagcactgggcctcgcactgtgctctacgaaggccctgtc
cgtgggctctgcccctttgctccccgaaactccaacaccatggcagctgctgccctggct
gcccccagcctaggctttgacaacgtgatcggggtgcttgtggcggatctcagcctcgcg
gacatgcacgtggtggacgtggagctgagaggacccccggggcccacgggccggaatttc
gctgtgcacacccaccgggagaacccagcggagccaggcgctgtcaccggctccgccact
gttgctgccttctggcgcagcctcctggcaggagccgagggcagcatgtcccaggcccca
ggagcacggccgagcccaccctccgtgtaccacgagcggcagcgcctggagctgtgtgcc
gtccacgccctcaacaacgttctgcagcagcagctctttagccaggaggctgccgatgag
atctgcaagaggctggcccccgactcccggctgaacccccaccgcagcctcctgggtacc
ggcaactatgacgtcaacgtgatcatggcggccctgcaggggctgggcctggccgctgta
tggtgggaccgcaggaggcccctgtcccagctggccctgccccaggtgctggggctgatc
ctgaacctgccctcgcccgtgtcgctggggctgctgtccctgccactgcgccggcggcac
tgggtggccctgcgccaggtggacggcatctactacaacctcgactccaaactgcgggcg
ccggaggcccttggggacgaggatggtgtcagggcctttgtggcggccgccctggcccga
gggctgtgtgaggtgctgctggtggtgaccaaggaggtggaggagaagggctgctggctg
cagacagactga

DBGET integrated database retrieval system