KEGG   Heterocephalus glaber (naked mole rat): 101725528Help
Entry
101725528         CDS       T02812                                 

Definition
liver carboxylesterase 1-like
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:hgl00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 566 aa AA seqDB search
MWLYTLVFAFLTTFTVWAGHTSSPPVVDTMHGKVLGKYVSLDGFAQPVAVFLGVPFAKPP
LGSLRFAPPEPAEPWSSVKNTTSYPPMCSQDAVAGQVLSELFTNRKEDIPLKFSEDCLYL
NIYTPADLTKKSRLPVMVWIHGGGLVVGGASTYDGVPLSAHENIVVVTIQYRLGIWGFFS
TGDEHSRGNWGHLDQVAALHWVQDNIANFGGNPGSVTIFGESAGSQSVSVLVLSPVAKNL
FHKAISESGVALIAALFRKDIKPLAEKIAVTAGCKTTTSAIMVHCLRQKTEDELLETTLK
MNFFSVDFFGDPREGHPFLPTVVDGVVLSKTPKEILEEKNFHTIPYIVGINKQEFGWILP
MMMGYPISEGKLDQQTAASLLWKSYSILNIPEELTPVVTEKYLGGTDDHFKKKDLFLDLI
ADLVFGVPAVTVARSHRDARAPTYMYEFQYQPSFSSSMKPKTVIGDHGDELFSVFGAPFL
KDGASEEEINLSKMMMKFWANFARNGNPNGEGLPHWPEYDQKEGYLQIGATTQAAQGLKA
KEMVFWNEFWAKEAMRKPTQREHIEL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtggctctatactctggtcttcgcctttctcaccactttcaccgtttgggcagggcac
acatcctcgccacctgtggtggacaccatgcatggaaaggtcctggggaagtatgtcagc
ctggatggatttgcccagcctgtggcagtcttcctgggagtcccttttgccaaaccccct
cttggatccctgaggtttgctcctccagaacctgcagagccatggagctctgtgaagaac
accacctcgtatcctcctatgtgctctcaagatgcagtggcagggcaggtgttgtcagag
ttgtttaccaacagaaaggaggacattcctctcaagttttctgaagactgtctgtaccta
aatatttacactcctgctgacttgacaaaaaaaagcaggctgccggtgatggtctggatc
catggaggtggtcttgtggtgggcggggcatccacctatgatggagtgcccctttctgcc
catgaaaacatagtggtggtaaccattcagtaccgcctgggcatctggggattctttagc
acaggtgatgaacacagccgagggaactggggtcacttagaccaggtggctgcgctgcac
tgggtccaggacaacattgccaactttggagggaacccaggctctgtgaccatctttgga
gagtcagctggtagtcaaagtgtttctgttcttgtgttatctcctgtagctaaaaacctc
ttccacaaggccatttctgaaagtggtgtggccctcattgctgctctgttcaggaaggac
atcaagcctttggctgagaaaattgctgttactgctgggtgcaaaaccaccacatcagcc
atcatggttcattgcctgcgacagaagacagaggatgagctcttggagacaactctgaaa
atgaatttttttagtgtggatttttttggagaccccagagagggccatcctttcttgccc
actgtagttgatggagtagtactgtcaaagacacctaaagagattctggaagaaaagaat
ttccacaccatcccctacatagtgggaatcaacaagcaagagtttggctggatccttcca
atgatgatgggctatccaatctctgaaggcaagctggaccagcagacagccgcatcactc
ttgtggaagtcctactccattcttaacatccctgaggaactgactcctgtggtcaccgag
aagtatttaggagggacagatgatcatttcaaaaagaaagacctattcctggacttgatt
gcagacttggtatttggtgtccctgctgtgactgtggctcgtagccacagagatgccaga
gcccccacctacatgtatgagttccagtatcaaccaagcttctcatcatccatgaaaccc
aagaccgtgataggagaccatggagatgagctcttctcagtatttggtgctccattttta
aaagatggtgcctcagaagaggagatcaacctcagcaagatgatgatgaaattctgggcc
aactttgctcgcaatgggaaccccaatggggaaggtttgccccattggccagagtatgac
cagaaggaaggatacctgcagattggtgctaccactcaagcagcccaggggctgaaagca
aaggaaatggttttctggaatgagttctgggccaaggaagcaatgaggaagccaacccag
agagaacatattgagctctga

DBGET integrated database retrieval system