KEGG   Heterocephalus glaber (naked mole rat): 101725536Help
Entry
101725536         CDS       T02812                                 

Gene name
Clock
Definition
clock circadian regulator
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Circadian rhythm
Dopaminergic synapse
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    101725536 (Clock)
  Environmental adaptation
   04710 Circadian rhythm
    101725536 (Clock)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101725536 (Clock)
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101725536 (Clock)
Transcription factors [BR:hgl03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101725536 (Clock)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 867 aa AA seqDB search
MLFTISCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEFYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLNSVSTSAHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPTHEKMAQRRSSF
SSQSINSQSVGPSLTQPVMSQAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNTSAIQQLTSINMQSQ
VVPANQIQSGMSAGHMGTSQHLMQQQTLQSTSTQQSQQSVLSGHSQQTSLPSQTQSALTA
PLYNTMVISQPAPGSMVQIPSSMSQNSTQGGAVTTFTQDRQIRFSQGQQLVTKLVTAPVA
CGAVMVPSTMLMGQVVTAYPTFTTQQQQAQTLSVTQQQQQQQQQQQQQQQQQQQQQQQQQ
QSSQEQQLPSVQQPSQAQLTHPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQ
QHQSQQPQQLGRHRTDSLTDPSKVQPQ
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttaccataagctgtagtaaaatgagctcgattgttgacagagatgacagtagt
atttttgatgggttggtggaagaagatgacaaggacaaagccaaaagggtatctagaaac
aaatctgaaaagaaacgtagagatcaatttaatgttctcattaaagaactgggatccatg
cttcctggaaatgctagaaagatggacaaatctactgttttgcagaagagcattgacttt
ttacgcaaacataaagaaatcactgcacagtcagatgctagtgaaattcgacaagactgg
aaacctacattccttagtaatgaagagtttacacaattaatgttagaggctcttgatggt
ttttttttagcaatcatgacagatggaagtataatatatgtgtctgagagtgtaacttca
ttacttgaacacttaccatctgatcttgtagatcaaagtatatttaattttatcccagaa
ggggaacattcagagttttataaaatactctctacccatctgctggaaagtgattcatta
actcctgaatacttaaaatcaaaaaaccaattggaattctgttgtcatatgcttcgagga
acaatagacccaaaggagccatctacctatgaatatgtgagatttataggaaatttcaaa
tctttaaacagcgtttccacttcagcacataatggttttgaaggaaccatacagcgcaca
cataggccttcttatgaagatagagtttgttttgtagctactgtcaggttagctacacct
cagttcatcaaggaaatgtgtactgttgaagaacccaatgaagaatttacatctagacat
agtttagaatggaagtttctatttctagatcacagggcaccaccaataataggatatttg
ccatttgaagttctgggaacatcaggctatgattactatcatgtggatgacctagaaaat
ctggcaaaatgtcatgagcacttaatgcaatacgggaaaggtaaatcatgttattacagg
ttcctgaccaaagggcaacagtggatttggcttcaaactcattattatatcacttatcat
cagtggaattcaaggccggagtttattgtttgtacacacactgtagtaagttacgcagaa
gtaagggctgaaagacgacgagaacttggtattgaagagtctcttcctgagacagctgct
gacaaaagccaagattctgggtctgataatcgaataaacacggtcagtctcaaagaagca
ttggaaaggtttgatcacagcccaaccccttctgcctcctcccggagttcaagaaaatca
tctcacacagcagtctcagacccttcctcaacaccaacaaagatcccaacggatactagc
actcctcccagacagcatttaccaactcatgaaaagatggcacaaaggagatcatcattt
agtagtcaatccataaattcccagtctgttggtccttctttaacacagccagtgatgtct
caagctgcaaatttaccaattccacaaggcatgtctcagtttcagttttcagctcaatta
ggagccatgcagcatctgaaagaccagttggagcaacggacacggatgatagaggcaaat
attcatcgacaacaagaagaactaaggaaaattcaagaacaacttcaaatggtccatggt
caggggctgcagatgtttttgcaacagtcaaaccctggattgaattttggttctgttcaa
ctttcttctggaaatacatctgctatccagcagctcacatctataaatatgcaaagccag
gttgttcctgccaaccagattcaaagtggaatgagtgctggacacatgggcacaagtcag
cacctgatgcaacaacagactttacaaagtacatcaactcagcaaagtcaacagagtgta
ctgagtgggcacagtcaacaaacatctcttcccagtcagacgcagagcgctcttacggcc
ccactgtataacacgatggtcatctctcagcctgcacccgggagcatggtccagattcca
tccagcatgtcacagaacagcacccagggtggtgcagtaaccacattcactcaggacaga
caaataagattttctcaaggtcagcaacttgtgaccaaattagtgactgctcctgtagct
tgtggagcagtcatggtacctagtactatgcttatgggtcaggtggtgactgcctatcct
actttcaccacacaacagcagcaggcacagactttgtcggtgacacagcagcaacaacag
cagcagcaacaacagcagcagcaacagcaacagcagcagcagcagcagcagcaacaacaa
cagagttcccaggagcagcagcttccttcagttcagcaaccatctcaggctcagttgacc
catccaccacagcagtttttacagacttctagattgctccatgggaatccctcaactcag
ctcatcctctctgctgcatttccactacagcagagcaccttccctcagtcacatcaccag
caacaccagtcccagcaaccgcagcaacttggtcgtcataggactgacagtttgactgat
ccttctaaggttcaaccgcagtag

DBGET integrated database retrieval system