KEGG   Heterocephalus glaber (naked mole rat): 101725537Help
Entry
101725537         CDS       T02812                                 

Gene name
Maoa
Definition
monoamine oxidase A
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101725537 (Maoa)
   00330 Arginine and proline metabolism
    101725537 (Maoa)
   00340 Histidine metabolism
    101725537 (Maoa)
   00350 Tyrosine metabolism
    101725537 (Maoa)
   00360 Phenylalanine metabolism
    101725537 (Maoa)
   00380 Tryptophan metabolism
    101725537 (Maoa)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101725537 (Maoa)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    101725537 (Maoa)
   04726 Serotonergic synapse
    101725537 (Maoa)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    101725537 (Maoa)
   05031 Amphetamine addiction
    101725537 (Maoa)
   05034 Alcoholism
    101725537 (Maoa)
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     101725537 (Maoa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 527 aa AA seqDB search
MASPEKASTAGLMFDVVVIGGGISGLAAAKLLSEHDLSVLVLEARDRVGGRTYTVRNEHV
NWVDVGGAYVGPTQNRILRLSKELGLETYKVNVNERFVHYVKGKTYPFRGAFPPVWNPLA
YLDYNNLWRTMDDMGKEIPADAPWEAPHAQEWDKMTMKDLIDKICWTKTAKQFATLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSITNGGQERKFKGGSGQVCEKIMGLLGDGVKL
SRPVTYVDQSGDNVIIETLNHELYECRYVISAIPPTLTAKIHFRPELPPERTQLIQRLPM
GSVIKCMMYYREAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSVPAIMGFILARKADR
LAKLHKEIRKRKICELYAKVLGSQEALEPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGKIYFAGTETATQWSGYMEGAVEAGERAAREVLNVLGKVAKKDIWVQEPECKD
VLSVEITHTFLERNLPSVPGLLKIIGISTSLTAFWFVLHKYKLLPQS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtccagagaaagcaagtactgcaggcctcatgttcgacgtagtggtgatagga
ggcggcatttcagggttggctgctgccaaattattgtctgaacatgatcttagtgttttg
gttttagaagccagggacagagttggaggaagaacatacactgtgaggaatgaacacgtt
aattgggtagatgttggtggagcctatgtgggaccgacccagaacagaatcttgcgcttg
tctaaggagctgggcctagaaacttacaaagtgaacgtcaatgagcgttttgttcattat
gtcaaggggaaaacttatccatttcggggagcatttccccctgtatggaatcctcttgca
tatttggattacaacaatctgtggcggacaatggatgacatgggaaaagagattccagct
gatgcaccctgggaggccccacatgcccaggagtgggacaagatgaccatgaaagatctc
atcgataaaatctgctggacaaagactgctaagcagtttgctactctgtttgtgaatatc
aatgtgacctctgagccccatgaggtctctgctctgtggttcctgtggtatgtgaagcag
tgcggtggcaccactcggatattctcaatcaccaatggaggccaggaacggaagtttaag
ggtggatccggtcaagtatgtgaaaagataatgggcctcctaggtgatggagtgaagctg
agccgtcctgtcacctatgttgaccaatcaggtgacaacgtcattatagagacactgaat
cacgaactctatgagtgcagatatgtaattagtgccatccctccaactttaactgccaag
atccacttcagaccagaacttccgccagagagaacccaattaatccagcgccttccaatg
gggtctgtcattaagtgcatgatgtattatagggaagccttctggaagaaaaaggattac
tgtggctgtatgatcattgaggatgaagatgccccaatttcaataaccctggatgacacc
aaaccagatggatcagtgcccgccatcatgggcttcatacttgcccggaaggctgatcga
cttgctaagctccataaggaaataaggaagaggaaaatctgtgagctatatgccaaagtg
ttgggatctcaagaagctttagaaccggtgcattatgaagagaagaactggtgtgaggag
cagtactctgggggctgctacacagcctacttcccccccggcatcatgacccagtatgga
agggtgattcgccagcccgtgggtaagatttactttgctggcacagagactgccacacag
tggagcggttacatggagggagcagtcgaggctggagaacgggcagctagagaggttttg
aatgttcttgggaaggtggccaagaaggatatatgggtacaagaacctgagtgtaaggat
gttctatcggttgagatcacccataccttcttggagaggaacctgccttctgtgcctggc
cttctgaagatcattgggatttcaacctctctaactgccttctggtttgtgttacataag
tacaagctactgccacagtcctga

DBGET integrated database retrieval system