KEGG   Heterocephalus glaber (naked mole rat): 101725537Help
Entry
101725537         CDS       T02812                                 

Gene name
Maoa
Definition
monoamine oxidase A
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hgl00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hgl00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hgl00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:hgl00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:hgl00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hgl00380]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:hgl00982]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hgl04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hgl04726]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hgl05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hgl05031]
Human Diseases; Substance dependence; Alcoholism [PATH:hgl05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 527 aa AA seqDB search
MASPEKASTAGLMFDVVVIGGGISGLAAAKLLSEHDLSVLVLEARDRVGGRTYTVRNEHV
NWVDVGGAYVGPTQNRILRLSKELGLETYKVNVNERFVHYVKGKTYPFRGAFPPVWNPLA
YLDYNNLWRTMDDMGKEIPADAPWEAPHAQEWDKMTMKDLIDKICWTKTAKQFATLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSITNGGQERKFKGGSGQVCEKIMGLLGDGVKL
SRPVTYVDQSGDNVIIETLNHELYECRYVISAIPPTLTAKIHFRPELPPERTQLIQRLPM
GSVIKCMMYYREAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSVPAIMGFILARKADR
LAKLHKEIRKRKICELYAKVLGSQEALEPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGKIYFAGTETATQWSGYMEGAVEAGERAAREVLNVLGKVAKKDIWVQEPECKD
VLSVEITHTFLERNLPSVPGLLKIIGISTSLTAFWFVLHKYKLLPQS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtccagagaaagcaagtactgcaggcctcatgttcgacgtagtggtgatagga
ggcggcatttcagggttggctgctgccaaattattgtctgaacatgatcttagtgttttg
gttttagaagccagggacagagttggaggaagaacatacactgtgaggaatgaacacgtt
aattgggtagatgttggtggagcctatgtgggaccgacccagaacagaatcttgcgcttg
tctaaggagctgggcctagaaacttacaaagtgaacgtcaatgagcgttttgttcattat
gtcaaggggaaaacttatccatttcggggagcatttccccctgtatggaatcctcttgca
tatttggattacaacaatctgtggcggacaatggatgacatgggaaaagagattccagct
gatgcaccctgggaggccccacatgcccaggagtgggacaagatgaccatgaaagatctc
atcgataaaatctgctggacaaagactgctaagcagtttgctactctgtttgtgaatatc
aatgtgacctctgagccccatgaggtctctgctctgtggttcctgtggtatgtgaagcag
tgcggtggcaccactcggatattctcaatcaccaatggaggccaggaacggaagtttaag
ggtggatccggtcaagtatgtgaaaagataatgggcctcctaggtgatggagtgaagctg
agccgtcctgtcacctatgttgaccaatcaggtgacaacgtcattatagagacactgaat
cacgaactctatgagtgcagatatgtaattagtgccatccctccaactttaactgccaag
atccacttcagaccagaacttccgccagagagaacccaattaatccagcgccttccaatg
gggtctgtcattaagtgcatgatgtattatagggaagccttctggaagaaaaaggattac
tgtggctgtatgatcattgaggatgaagatgccccaatttcaataaccctggatgacacc
aaaccagatggatcagtgcccgccatcatgggcttcatacttgcccggaaggctgatcga
cttgctaagctccataaggaaataaggaagaggaaaatctgtgagctatatgccaaagtg
ttgggatctcaagaagctttagaaccggtgcattatgaagagaagaactggtgtgaggag
cagtactctgggggctgctacacagcctacttcccccccggcatcatgacccagtatgga
agggtgattcgccagcccgtgggtaagatttactttgctggcacagagactgccacacag
tggagcggttacatggagggagcagtcgaggctggagaacgggcagctagagaggttttg
aatgttcttgggaaggtggccaagaaggatatatgggtacaagaacctgagtgtaaggat
gttctatcggttgagatcacccataccttcttggagaggaacctgccttctgtgcctggc
cttctgaagatcattgggatttcaacctctctaactgccttctggtttgtgttacataag
tacaagctactgccacagtcctga

DBGET integrated database retrieval system