KEGG   Heterocephalus glaber (naked mole rat): 101725713Help
Entry
101725713         CDS       T02812                                 

Definition
pancreatic alpha-amylase-like
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hgl00500]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:hgl04973]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 508 aa AA seqDB search
MKLFLLLSALGLCWAQYAPHTQQGRTSIVHLFEWRWADIAAECERYLGPKGFGGVQVSPA
NENVVINNPYRPWWERYQPVSYKLCTRSGNEAEFKNMVTRCNNVGVRIYVDAVINHMCGS
GNPAGTSSTCGSYYNPNNRDFPAVPYSGLDFNDNKCNGEISNYNDASQVRNCRLSGLLDL
ALEKDYVRTKIADYLNHLIDIGVAGFRLDAAKHMWPGDIKAVLNKLHNLNTSWFSAGSRP
FIFQEVIDLGGEAIKSSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVP
SDRALVFVDNHDNQRGHGAGGASILTFWDARMYKMAVGFMLAHPYGFTRIMSSYRWDRNF
QNGKDVNDWIGPPNNNGATKAVTINADSTCGNGWVCEHRWRQIRNMAAFRNVVDGQPFSN
WWDNGSNQVAFGRGNRGFIVFNNDDRSLSTTLQTGLPAGTYCDVISGDKVNGNCTGIKIQ
VGGDGKASFSISNSAEDPFIAIHAESKL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctttctgctgctctcagcccttgggctctgctgggctcagtatgccccacac
actcaacagggacgcacatctattgtccacctgtttgagtggcgctgggccgacattgct
gcggaatgtgaacgatacttaggtccaaagggatttggaggggttcaggtttctccagcc
aatgaaaatgttgtaattaacaacccttatagaccttggtgggaaagatatcaaccagtt
agctataaattatgcacaagatctggaaatgaagctgaattcaaaaacatggtgactagg
tgtaacaatgttggtgttcgaatttatgtggatgctgtaattaatcacatgtgcggttca
ggcaatcctgcaggaacaagcagtacttgtggaagctactacaatcctaacaatagagac
tttccagcagttccatactctggtttggattttaatgataataaatgtaatggagaaatt
agtaactataatgatgcttctcaggtcagaaactgtcgtctctctggtcttcttgatctt
gcacttgagaaggattacgtgcgaaccaagattgctgactacctgaaccatctcattgac
attggtgttgcagggttcagacttgatgctgctaagcacatgtggcctggagacatcaag
gcagttttgaataaattgcataatctgaacacaagttggttctctgcaggaagtcgacct
ttcattttccaggaggtaattgatttgggtggtgaagcaattaaaagtagtgaatacttt
ggaaatggccgtgtgactgaattcaagtatggtgcaaaactaggcacagttattcgcaag
tggaatggagagaagatgtcttacttaaagaactggggagaaggttggggctttgtgcct
tctgacagagcacttgtctttgtggataaccatgacaatcagcgaggtcatggagctgga
ggagcatctattcttacattctgggatgctagaatgtataaaatggctgtgggatttatg
cttgctcatccttatggatttacacgaataatgtcaagctaccgttgggaccgaaatttt
cagaatggaaaagatgttaacgactggatcgggccaccaaataacaatggagcaactaaa
gcagtgactattaacgcagactccacttgtggcaatggctgggtctgtgaacatcgctgg
cgccaaataaggaacatggctgctttccgaaatgtagttgatggccagcctttctcaaac
tggtgggataatggaagcaaccaagtagcttttggaagaggaaacagaggattcattgtt
tttaacaatgatgacaggtcactgtctacaactttgcaaactggtctacctgctggcaca
tattgtgatgtcatttctggagataaagttaatggcaactgcacaggaattaaaatccag
gttggtggtgatggcaaggcttctttttctattagcaactcggctgaagacccatttatt
gccattcatgctgaatcaaagttgtaa

DBGET integrated database retrieval system