KEGG   Heterocephalus glaber (naked mole rat): 101726023Help
Entry
101726023         CDS       T02812                                 

Gene name
Entpd2
Definition
ectonucleoside triphosphate diphosphohydrolase 2
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    101726023 (Entpd2)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     101726023 (Entpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 495 aa AA seqDB search
MAGKALSLLPPLLLATAGLAGLLLLCVPTRDVQEPPALKYGIVLDAGSSHTSMFIYKWPA
DKENDTGIVGQHSSCDVQGGGISSYADDPSKAGRSLVECLEQALRDVPTERHAATPLYLG
ATAGMRLLNLTRPEASASVLAAVTQTLTQYPFDFRGARILSGQDEGVFGWVTANYLLENF
IKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTQPAEDPANEVHLRLYGQRYRVYTHSF
LCYGRDQVLQRMLASALQTHRSHPCWPRGYSTQVLLGNVYQSPCTGAQRPQAFNSSARVT
VSGTSDPELCRGLATELFNVSSCSFSQCSFNGVFQPPLSGSFIAFSAFYYTVDFLRTVMG
LPTATLKQLDAAAVTTCNQTWAQLQARAPEQKARLADYCAGAMFVQQLLSRGYGFDERKF
SGVAFQRKAADSAVGWALGYMLNLTNLIPADPPGLRKGTAFSSWVVLLLLFAALLLAALV
LLLRRVRSTKAQNVI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaaggcgctgtcgctcctgccaccgctgctgctggccacggcgggcctcgcc
ggcctcctgctgctgtgcgtccccacccgcgacgtccaggagccgcccgccctcaagtac
ggcatcgtgctggatgctggctcttcacacacatctatgtttatctacaagtggccggca
gacaaggagaatgacacaggcattgtggggcagcacagctcctgtgacgttcagggtggg
ggtatctccagctatgcagacgacccttccaaggcaggacggagcctggtggaatgcctg
gaacaggccctgcgggatgtacccacagagagacatgctgccacacccctgtacctgggc
gccacagcaggcatgcgcttgttgaacctaacccgaccagaggcctcagccagtgtgctg
gctgcagtgacacagacgctgacccagtaccccttcgactttcggggggcacgcatcctg
tcgggccaggatgagggagtgtttggctgggtgactgccaactatctgctggagaacttc
atcaagtatggctgggtaggccggtggttccggccaaggaagggaaccctgggggccatg
gacctgggaggtgcatccacccagatcaccttcgagacgactcagccagccgaggatcct
gccaatgaggtccaccttcggctctacggccagcgctaccgagtctatacccacagcttc
ctctgctatggccgagaccaggtcctccagaggatgctggccagtgccctccagacccac
cgctcccacccttgctggccaaggggctactccacccaagtgctgctcgggaatgtgtac
cagtcaccctgtaccggggctcagcggccccaagccttcaacagcagcgccagggtcact
gtgtcgggcaccagtgatcctgagctctgccgtggcctggccacggagctctttaacgtc
tcctcctgttctttctcccagtgctccttcaacggggtcttccagcccccactgtctggg
agcttcatcgccttctctgccttctactacaccgtggacttcctgcggaccgtcatggga
ctgcccaccgctactctgaagcagctggacgccgccgcggtgaccacctgcaaccagacc
tgggctcagctgcaggctcgggcgccagagcagaaggcccgcctggctgattactgtgcc
ggggccatgttcgtgcagcagctgctgagccgtggctacggctttgacgagcgcaaattc
agcggtgtggccttccagaggaaggcagcggacagcgcggtgggctgggcgctgggctac
atgctgaacctcaccaacctgatccccgccgacccaccggggctgcgcaagggcacggcc
ttcagctcctgggtggttctcctgctgctcttcgccgccttgctcctggcggcgcttgtc
ctgctgctgcgccgagtgcgctccaccaaggcgcaaaatgtcatctag

DBGET integrated database retrieval system