KEGG   Heterocephalus glaber (naked mole rat): 101726492Help
Entry
101726492         CDS       T02812                                 

Gene name
Tymp
Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00240  Pyrimidine metabolism
hgl00983  Drug metabolism - other enzymes
hgl01100  Metabolic pathways
hgl05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101726492 (Tymp)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101726492 (Tymp)
 Human Diseases
  Cancers
   05219 Bladder cancer
    101726492 (Tymp)
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     101726492 (Tymp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C
Motif
Other DBs
NCBI-GeneID: 101726492
NCBI-ProteinID: XP_012927961
Position
Un
AA seq 533 aa AA seqDB search
MRLRSGSQSRVRRVDIRDTGAGSGQMNVAAKTRTRGQVPGCLLSRRPGAMAARGAWPPPT
PALGGLFGVGGRGPPDPAPEPKQLPELIRRKRDGERLSEEDIRHFVHAVVEGSAQDTQIG
AMLMAIRLRGMDLEETFALTQALAKSGQQLEWPEAWHQQLVDKHSTGGVGDKVSLVLAPA
LAACGCKVPMISGRGLGHTGGTLDKLESIPGFSVIQSPEKMQMLLERVGCCIVGQSKELV
PADGLLYAARDVTATVDSLPLITASILSKKIVEGLSALVVDVKYGGAAVFPDQEQARELA
RALVDVGAGLGMRVAAALTAMDNPLGRSVGHALEVEEALLCLDGAGPRDLRDLVSQLGGA
LLWLSGQVGTHAQGAVRVTTALDDGSARGRFERMLAAQGVDPGLARALCSGTPAQRRQLL
PRAREQEELCALEDGTVERIQALPLALVLRELGAGRSRAGETIRLGVGAELLVDVGQRLR
RGTPWLRVHLDRPALSTPQRHALQEALVLSERAPFEAPSPFTQLVLPPPVSQS
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgagaagtggaagccagtcacgggtcagaagggtggacatcagagacaccgga
gcagggtcgggacaaatgaacgtagccgcaaagacacggacacggggtcaggttccaggg
tgtctcctttcccgcaggcccggagcaatggcggcccggggagcctggcccccacctacc
cctgcgctaggtggcctcttcggggtagggggacggggacctccagaccctgctccagag
cccaagcagctcccggagctgattcgcaggaaacgagacggagagcgtctgagtgaggag
gatatcaggcacttcgtgcatgcggtggtggaaggcagcgcacaggatacacagatcggg
gccatgctgatggccatccggcttcggggcatggatctggaggagacctttgcattgact
caggccctggccaagtctgggcagcaactggagtggccagaggcctggcaccagcagctg
gtggacaaacattccacagggggcgtgggtgacaaggtcagcctggtcctggcacctgcc
ctggctgcatgtggctgcaaggtgccaatgatcagtggacgtggcctggggcacacaggt
ggcaccctggataagttggagtccattcctggattcagtgtcatccagagcccagaaaag
atgcaaatgctgctggagcgagtgggctgctgtatcgtgggtcagagtaaggagctggtc
cctgcggatggactcctgtatgcagctcgagatgtgacagccaccgtggacagcctgcca
ctcatcacagcctccatcctcagtaagaagatcgtggagggtctatccgctctggtggtg
gatgttaagtatggtggggccgcagtcttccctgaccaggaacaggcccgggagctggca
agggcactggttgacgtaggggcaggcctggggatgagggtggcggccgccctaaccgct
atggacaatcctctgggccgcagcgtgggccacgccctggaggtggaggaagcgctgctt
tgcctggacggtgcagggccaagggacctgcgagacctggtctctcagctcggtggcgcc
ctgctctggctgagcggacaggtggggacccacgcgcagggcgccgtgcgggtgaccacg
gcgctggacgacggctctgcaaggggccgcttcgagagaatgctcgcggcgcagggggtg
gacccaggcctggccagagcgctgtgctccgggacccccgcccagcgacgccagctgctg
ccccgcgcgcgcgagcaggaggagctctgtgcgctagaggacggcaccgtggagcgcatc
caggcgctaccgctcgctcttgtgctgcgtgagctcggggctggacgcagccgcgccgga
gagacgatccggctgggggtaggggccgagctgctggtcgacgtgggccagaggctgcgc
cgcgggacgccctggctccgcgtacacctggaccgcccggcgcttagcaccccgcagcgc
cacgccctgcaagaggccctcgtgctgtccgaacgcgcgcccttcgaagccccatcgccc
ttcacccagctggtcctgccgccgcccgtctcacagtcctaa

DBGET integrated database retrieval system