KEGG   Heterocephalus glaber (naked mole rat): 101726578Help
Entry
101726578         CDS       T02812                                 

Gene name
Ncoa1
Definition
nuclear receptor coactivator 1
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101726578 (Ncoa1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101726578 (Ncoa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1393 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRINPSVNPSISPAHGVARSSTLPPSNSNMVSTRVNR
QQSSDLHSSSSHTNSSNNQGSFGCSSGNQIVANVALSQGQASSQSSNPSLSLNNSAMEGT
GISLTQFMSPRRQVPSGLATRARMSNNSFPPNIPTLNSPVGMTSSGCNNSNRSYSNIPVT
SLQGMSEGPSNSVGFSANSPVLRQMSSQNSPSRLNLQPAKAESKDNKEIASILNEMIQSD
NSSGDGKPLDSGLLHNNDRLADGDSKYAQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLS
CTGTSNSASANSSGGTCPSSHSSLTERHKILHRLLQEGSPSDITTLSVESDKKDSASTSV
SVTGQAQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKE
QMDPCNTNPTPVTKPAPEEIKLESQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGA
ATSVTIKSEILPASLQSSTARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWANNAVTAV
NQTKPEEYGFFSNKGGGLDVLSERFPPQQATPPLMMEERPNLYPQPYSSPSPTASLPSPF
QGMVRQKPSLGTMPVQVTPPRGAFSPGIGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQL
IHQNRQAILNQFAAAAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQ
QQRAMLMRQQSFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFS
QLAANPEASLATRNSMVSRGMAGNMGGQFGTAINPQMQQNVFQYPGSGMVPQSEANFAPS
LSPGSSMVPMPIPPPQSSLLQQTPPSSGYQSPDMKAWQQGAMGSNNVFGQAVQNQPTPAQ
PGVYNNMSITVSMAGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCPEQINDPALRHTGLYC
NQLSSTDLLKTEADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGSQKPTPGPQTPQ
AQQKSLLQQLLTE
NT seq 4182 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggacagttcatctgatcctgctaacccagactcacataagagaaaa
ggatcaccttgtgacacactggcctcaagcactgaaaagaggcgcagggaacaagaaaat
aaatacttagaagagctagctgagttactgtctgccaacatcagtgacattgacagcttg
agtgtaaaaccagacaaatgcaagattttgaagaaaacagtcgatcagatacagctaatg
aagagaatggaacaagagaaatcaacaactgatgatgatgtacagaaatcagatatatca
tcaagtagtcaaggagtgatagaaaaagaatccttaggacctcttcttttggaggctttg
gatggatttttctttgttgtgaactgtgaagggagaattgtatttgtgtcagagaatgtg
accagctacttgggttacaatcaggaggaattaatgaataccagcgtctacagcatactg
cacgtgggggaccacgcagaatttgtcaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgccgaaatagccatacttttaactgcaggatgcta
attcaccctccagatgagccaggtaccgagaaccaagaagcttgccagcggtacgaagta
atgcagtgtttcactgtgtcgcagccaaaatcaatccaagaggatggagaagatttccag
tcatgtttgatttgtattgcacggcgattacctcggcctccagcaattacaggcgtagaa
tcctttatgaccaagcaagatactacaggcaaaatcatctctattgataccagttccctg
agagctgctggcagaactggctgggaagatttagtgaggaaatgcatttatgcttttttc
cagcctcaaggcagagagccatcttatgctagacaactatttcaagaagtgatgactcgt
ggcactgcctccagcccatcctatagattcatactgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcagagtccagacatgcagcctttcatcatggga
attcatatcatcgacagggaacacagtgggctttctcctcaagatgacactaattctgga
atgtcaattccccgaataaacccctcagtcaatcctagtatctctccagctcatggtgtg
gcccgttcatccacattgccaccatccaacagcaacatggtatccaccagagtaaatcgc
caacagagctcagatcttcatagcagcagcagtcacactaattctagcaacaaccaaggg
agttttggatgctcatctggaaatcagattgtagccaatgttgccttaagccagggacag
gccagttcccagagcagtaatccatctttaagcctcaataattctgctatggaaggtaca
ggaatttccctcacacagttcatgtctccaaggagacaggttccctctggcttagcaaca
agggccaggatgtcaaacaattcatttcctccaaatattccaactttaaactccccagtt
ggcatgacaagtagtggctgtaataatagtaaccgatcttactcaaatatcccagtaaca
tctttacagggtatgagtgaaggacccagtaactctgttggcttctctgccaattctcca
gtactcaggcagatgagctcacagaattcacctagcagattaaatttacaaccagcaaaa
gctgagtccaaagataacaaagagattgcatccattttaaatgaaatgattcagtctgac
aacagctctggtgatggcaaacctctggattcagggcttctgcataacaatgacagactt
gcagatggagacagtaaatatgctcaaaccagtcataaactagtgcagcttttgacaaca
acagcagaacagcagttacggcatgcagatatagacacaagctgcaaagatgtactgtct
tgcacgggcacttccaactctgcctctgctaactcctcaggaggtacttgtccttcttct
catagctcactgactgagcggcacaaaattctgcaccggctcttgcaagaagggagtccc
tcagacatcaccactctgtctgtggagtccgataaaaaggacagtgcatctacttctgtg
tcagtgactggacaggcccaagggaactctagtataaaactagagctggatgcttcaaag
aaaaaagaatcaaaagaccatcagctcctgcgctaccttttagataaagatgagaaagac
ttaagatcaactccaaacctgagcctggatgatgtaaaggtgaaagtggaaaagaaagaa
caaatggatccttgtaacacaaacccaaccccagtgaccaaaccagcccctgaggaaatt
aaactggagtcccagagccagtttacagctgaccttgaccagtttgatcagttgctgccc
acgctcgagaaggcagcacagttgccaggcttatgtgagacagacaggatggatggtgca
gccaccagtgtaaccatcaaatcggagatcctgccggcctcacttcagtcctccactgcc
agacccacttccagactgaatagattgcctgagctagaattagaagcaattgataaccag
tttggacaaccaggaacaggtgatcagattccttgggcaaacaatgctgtgacagctgta
aatcagacaaaaccagaagagtatggatttttttcaaataaggggggtggattagatgta
ttgtcagagagatttccaccacaacaagcaacaccacctttgatgatggaagaaagaccc
aacctctatccccagccttactcttctccttctcctactgccagtctccccagccctttc
caaggcatggtcagacagaagccttcactggggaccatgcctgttcaggtaacgccaccc
cgaggcgctttttcacctggcataggcatgcagcccaggcagactctaaacagacctcca
gccgcacccaaccaacttcgacttcagctacagcagcgattgcagggacaacagcagttg
atacaccaaaatcggcaagctatcttgaaccagtttgcagcagctgctccggttggcatt
aatatgagatcaggcatgcagcagcaaatcacacctcagccacccctgaatgctcagatg
ttggcgcagcgtcagcgggagttgtacagtcagcagcaccgacagaggcagctaatacag
cagcaacgagccatgctcatgaggcagcaaagctttgggaataacctccctccctcatct
ggactgccagttcaaatggggaacccccgtcttcctcagggtgctccacagcaattcccc
tacccaccaaactatggtacaaatccaggaactccacctgcttctaccagccccttttca
caactggcagcaaatcctgaagcatctttggccacccgcaacagcatggtgagcagaggc
atggcaggaaacatgggaggacagtttggcactgcaatcaatcctcagatgcagcagaat
gtcttccagtatccagggtcaggaatggttccccaaagtgaggccaactttgcaccatct
ctaagcccgggaagctccatggtcccaatgccaatccctcctcctcagagctctctgctg
cagcaaactccgccgtcctccgggtaccagtcaccagacatgaaggcctggcagcaagga
gcaatgggaagcaacaatgtgttcggtcaagctgtccagaaccagcccacacctgcacag
ccaggagtgtacaacaacatgagcatcaccgtgtccatggcaggtggaaatacaaatgtt
cagaacatgaacccaatgatgggccagatgcagatgagctctttgcagatgccaggaatg
aacactgtgtgccctgagcagataaatgacccagcactgagacacacaggcctctactgc
aaccagctgtcatccaccgaccttctcaaaacagaggcagatggaacccagcaggtgcaa
caggttcaggtgtttgctgacgtccagtgtacagtgaatctggtaggcggggacccttac
ctgaaccagcctggtccactgggatctcaaaagcccacgccaggaccacagaccccccag
gcccagcagaagagcctccttcagcagctactgactgaataa

DBGET integrated database retrieval system