KEGG   Heterocephalus glaber (naked mole rat): 101729056Help
Entry
101729056         CDS       T02812                                 

Definition
glycogen [starch] synthase, muscle-like
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101729056
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    101729056
   04152 AMPK signaling pathway
    101729056
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101729056
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101729056
Glycosyltransferases [BR:hgl01003]
 Polysaccharide
  Storage polysaccharide
   101729056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 130 aa AA seqDB search
MSARHMALAKAFPDHFTYEPHEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDEEEPRE
GPLEDGERYDEDEEAAKDRRNIRAPEWPRRSSCTSSTGKRSNSVDTAPSSSLSTPSEPLS
PASSLGEERN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcacgccacatggccctggccaaggcctttccggatcatttcacctacgagccc
cacgaagcggatgcagcccagggctaccgctacccacggccggcctcagtgccgccgtca
ccctcgttgtcacgacactcgagtccgcaccagagcgaggatgaggaggaaccccgggaa
gggccacttgaagatggcgaacgatacgacgaggacgaggaagctgccaaggatcggcgc
aacatccgcgcccccgagtggccacgccgctcctcctgcacctcttccacaggcaagcgc
agcaactcggtggacactgcgccctccagctcgctgagcacgcccagtgagcccctcagc
cccgccagctctctgggggaggagcgcaactaa

DBGET integrated database retrieval system