KEGG   Halorhodospira halophila: Hhal_0045Help
Entry
Hhal_0045         CDS       T00462                                 

Definition
succinate dehydrogenase, cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hha  Halorhodospira halophila
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hhal_0045
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hhal_0045
   00650 Butanoate metabolism
    Hhal_0045
  Energy metabolism
   00190 Oxidative phosphorylation
    Hhal_0045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(47682..48065)
Genome map
AA seq 127 aa AA seqDB search
MRRYETAVSRARGLGSAKNGFHHWWHQRLTALVLVPLMMWLGIGLALQAGADFEAARAWV
ANPFNATLLIAAIIMLFYHGALGVQVVIEDYVHLEGLKWFGNLAVYFACFLVAVAGILAV
IQIVLGG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggtacgagaccgccgtctcccgggcccgcggcctcggttcggctaagaacggc
ttccaccactggtggcaccaacgccttacggcgctggtgctggtcccgctgatgatgtgg
ctggggatcggactggccctgcaggcgggtgccgacttcgaggcggcccgggcatgggtg
gcgaacccgttcaacgccacgctgctcatcgcggccatcatcatgctcttctatcacggg
gcgctcggggtccaggtggtcatcgaagactacgtgcacctggaggggctgaagtggttc
ggcaacctcgctgtttacttcgcgtgtttcctggtggccgtcgccgggatcctggcggtc
atccaaatcgttctggggggctaa

DBGET integrated database retrieval system