KEGG   Halorhodospira halophila: Hhal_0078Help
Entry
Hhal_0078         CDS       T00462                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hha  Halorhodospira halophila
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Hhal_0078
Enzymes [BR:hha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Hhal_0078
Exosome [BR:hha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hhal_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(91497..93020)
Genome map
AA seq 507 aa AA seqDB search
MQQRYILALDQGTTSCRAILFDHQAQIVGVAQKELTQYYPQPGWVEHDAMEIWGAQMGVV
REVLEVHGVKPAELHAIGITNQRETTVLWDRHTGRPVHNAIVWQDRRTAPLCESLKERGL
EQQVRETTGLVIDAYFSATKIRWLLDNVPGVRERAEQGELLFGTMDTWLVWNLTRGACHV
TDYSNASRTMLYDIHRLAWDEGLLEALDIPRSLLPEVRPSCGSFGTTHPEMLGGAQIPIA
GIAGDQQAALFGQACFEPGMAKNTYGTGCFLLMHSGERPAVSESGLLTTIAWGIDGRVEY
ALEGAIFIAGAAIQWLRDELKLIDSAEDSEYFAGKVPDAGGVYVVPAFAGLGAPYWDMYA
RGAIFGLTRGTRKEHITRATLDALAYQTKDVIDAMGRDAGVPLKALRVDGGAAANNVLMQ
FQADLLGVRVERPPVIETTALGAAYLAGIAVGIWDQAAVAHQTAPERVFEPSMEDDERDR
LYRGWQKAVRRSMDWERESDGGVQQSE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcgctacatcctggccctcgatcagggcacgaccagctgccgtgccatcctc
ttcgatcaccaggcgcagatcgtcggggtcgcccagaaggagttgacccagtactaccct
cagccgggctgggtcgagcacgacgccatggagatctggggggcacagatgggtgtcgtg
cgcgaggtcctcgaggtccatggggtcaagccggccgagctgcacgccatcggcattacc
aatcagcgcgagaccaccgtcctctgggaccgccacacggggcggccggtgcacaacgcc
atcgtctggcaggaccggcgcacggcccccctgtgcgagtcgctcaaggagcgtggtttg
gaacaacaggtccgtgagaccacgggtttggtgatcgacgcgtacttctcggcgaccaag
atccgctggttgctggacaacgtcccgggggtgcgcgagcgggccgagcagggcgagctg
ctgttcggcaccatggatacctggctggtctggaacctgacccgcggggcctgccacgtc
accgactacagcaacgcctcgcgcaccatgctctatgacatccatcgtctggcgtgggat
gaaggcctcctggaggcactggatatcccacgctcgctgctgccggaggtgcgcccgtcg
tgcgggagcttcgggaccacgcacccggagatgctcggcggggcgcagatccccattgcc
ggcatcgccggtgatcagcaggcggcgctgttcgggcaggcgtgcttcgagccgggcatg
gccaagaacacctacggcaccggctgtttcctgctgatgcactccggtgagcggcctgcg
gtctccgagtcggggctgctcaccaccatcgcctggggcatcgacggacgcgtggagtat
gccctggagggggcaatcttcatcgccggtgccgccatccagtggctgcgcgatgaactg
aagctgatcgactcggcggaggactcggagtacttcgccggcaaggtaccggacgccggc
ggcgtctacgtcgtacccgccttcgccgggctcggcgcgccgtactgggacatgtacgcc
cggggggcgatcttcgggttgactcgggggacgcgcaaggagcacatcacccgcgctacc
ctcgacgccttggcgtatcagaccaaggacgtgatcgacgccatggggcgtgatgccgga
gtcccccttaaggcgctgcgcgtcgacggcggagcggcggccaacaacgtgctgatgcag
ttccaggccgatctgctgggcgtgcgggtcgagcggccaccggtcattgagacgaccgcc
ctgggcgccgcctacttggcgggtatcgccgtgggcatctgggatcaggcggcggtggcg
caccagacagcgccggaacgcgtcttcgaaccgtccatggaggacgacgagcgggaccga
ctctaccgggggtggcagaaggcggtgcgtcggagcatggactgggagcgggagtcggat
ggcggggtgcaacagtcggagtga

DBGET integrated database retrieval system