KEGG   Halorhodospira halophila: Hhal_0180Help
Entry
Hhal_0180         CDS       T00462                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hha  Halorhodospira halophila
Pathway
hha00010  Glycolysis / Gluconeogenesis
hha00620  Pyruvate metabolism
hha00640  Propanoate metabolism
hha00680  Methane metabolism
hha01100  Metabolic pathways
hha01110  Biosynthesis of secondary metabolites
hha01120  Microbial metabolism in diverse environments
hha01130  Biosynthesis of antibiotics
hha01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hhal_0180
   00620 Pyruvate metabolism
    Hhal_0180
   00640 Propanoate metabolism
    Hhal_0180
  Energy metabolism
   00680 Methane metabolism
    Hhal_0180
Enzymes [BR:hha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hhal_0180
Lipid biosynthesis proteins [BR:hha01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hhal_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABM60974
JGI: Hhal0180
UniProt: A1WTG2
Position
209714..211375
Genome map
AA seq 553 aa AA seqDB search
MVSSRDNGPPMGADEASFSWETVERQWLGAQDDGGFNLAYQCLERNIAAGRGGQEALIWR
GAEGERQVYSYQDLLDGALRFARALERRGVRLAERVCTLGPRRPELYLAALGTLRHGAVY
APLFSVYGPDPIRRRLELGEARVVITTRRLFEERIAPVRGALPALEHVVLVDDEAPGAAS
WEAFCANDAAPQPMATGAEYPALLHFTSGTSGPPKGVLHVHRAAAAHLATGREVLGLAPG
ERYWCTADPGWVTGVSYGILAPLLCGATLVVDEGEFDAQRWYGILATEGVRCWFTAPTAL
RMLRRAGPEALEGFDLSRLERIFSTGEPLDPALTEWTENHLGRPTRDAWWQSETGAIMTA
QYGDAPVRAGRMGRPVPGVELILAEADGDTVTPVTQPGTTGEILIRRGWPSMFRAYLGAP
ERYRAAFVDNWYRSGDLAQWDEQGELRFIGRADDVIKTAGHMVGPAEVEAVLNHHPEVAE
CGVSGIPDPVAGALVAAWVVTRRPPEAPEQLRRDLITHARQRLGAAVAPREIHFVDELPK
TPSGKILRRQLST
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggtcagcagccgggataacggaccgccgatgggcgcagacgaggcctcattctcttgg
gagaccgtggagcggcagtggctgggcgcccaggacgacggcggtttcaacctggcgtac
cagtgcctggagcggaacatcgccgccggccgcggcgggcaggaggcactgatctggcgc
ggcgccgaaggcgaacgccaggtgtacagctaccaggatctgctcgacggcgcgctacgc
ttcgcccgggcgctggagcgacgcggcgtgcgcctggccgagcgggtctgcaccctcggg
ccacgtcgcccggagctctacctggccgccctcggcaccctgcgccacggtgccgtctac
gcccccctgttctcggtctacggccccgacccgatccgccgtcgcctggaactgggcgaa
gcccgggtggtgatcaccacccggcggctcttcgaggagcgcattgccccggtgcgcggc
gcgctgccggcgctggagcacgtcgtcctggtcgatgacgaggcccccggcgcagcgtcg
tgggaggccttctgcgcgaatgacgccgccccccagccgatggcgaccggcgccgaatac
ccggccctgttgcacttcaccagtggcacgtccggcccgcccaagggggtgctccacgtc
caccgcgccgccgcggcccatttggccaccgggcgcgaagtgctaggcctggccccgggc
gagcgctactggtgcaccgccgacccggggtgggtcaccggggtctcctacggcatcctc
gcaccgttgctctgcggcgccaccctggtggtcgatgaaggcgagttcgacgcccagcgc
tggtacggcatcctcgccacggagggggttcggtgctggttcacggcacccacggccctg
cgcatgctgcgccgagccggccccgaggcactggagggcttcgacctgtcccgactcgaa
cggatcttcagcaccggcgaacccctggacccggccctcacggaatggaccgagaaccat
ctgggccgccccacccgggacgcctggtggcagtcggaaaccggcgccatcatgaccgcc
cagtacggtgatgcgccggtccgcgccggtcgcatgggccgccctgtgccgggcgtcgag
ctgattctggccgaggccgatggcgacaccgtcacccccgtgacccaaccggggaccacc
ggcgagatcctgatccgccgcggctggccgtccatgttccgcgcctacctgggcgcgccg
gagcgctaccgggccgccttcgtcgacaactggtaccgctccggcgacctagcccagtgg
gacgaacaaggcgagctgcgctttatcggccgagccgacgatgtcatcaagaccgccggg
catatggtggggccagcggaggtcgaggcggtcctgaaccaccacccggaggtggccgaa
tgcggggtgagcggcatccccgacccggtggccggcgccctggtcgcggcctgggtcgtc
acccgccgccctcccgaggccccggaacagctgcgccgggatctcatcacccatgcacga
cagcgcctcggcgcggcggtggcgccgcgcgagatccacttcgtggacgagctacccaag
acccccagcgggaagatcctacgccgtcagctgagcacgtga

DBGET integrated database retrieval system