KEGG   Halorhodospira halophila: Hhal_0230Help
Entry
Hhal_0230         CDS       T00462                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
hha  Halorhodospira halophila
Pathway
hha03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hha00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Hhal_0230
DNA repair and recombination proteins [BR:hha03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Hhal_0230
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Hhal_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH Toprim_2 PHF5 HHH_8 VSP
Motif
Other DBs
NCBI-ProteinID: ABM61024
JGI: Hhal0230
UniProt: A1WTL2
Position
complement(264413..265018)
Genome map
AA seq 201 aa AA seqDB search
MSVYSPRLRELVEGLRRLPGVGAKTAQRMALHLLQRDRDGARQLADALQRAVDGVGHCPE
CGLLTEEERCGLCASPQRRRTLLCVVESSADVFALEQATDFQGLYFVLGGALSPLDGIGP
EELGLDRLQQRLEAGEVEEIILATNPTIEGEATAHYVQSLAAERGVRTTRIAHGVPMGGA
LEQVDQGTLSHAFMGRRDYEG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtctactcgccgcggctgcgcgagctggttgaggggctgcgccggctgcccggg
gtgggcgccaagacggcgcagcgcatggcgctgcacctgctccagcgcgaccgggacggc
gcccggcagctggccgacgccctgcagcgggcggtggacggggtggggcactgccccgag
tgcggcctgctcacggaggaagagcgctgcgggctgtgcgccagtccgcagcgccgccgg
acgctgctgtgcgtggtggagagcagcgccgacgtcttcgccctcgagcaggccacggac
ttccaggggctgtacttcgtcctcggcggggcgctgtcgcccctggacggcatcggcccg
gaggagctggggctggaccggctgcagcagcggttggaggccggtgaggtcgaggagatc
atcctcgctaccaaccccaccattgagggcgaggccaccgcccactacgtccagagcctg
gccgccgagcgcggggtgcgcaccacgcggatcgcccacggggtgccgatgggcggcgcc
ctcgagcaggtggaccagggcaccctctcccacgccttcatggggcggcgggactacgag
ggctga

DBGET integrated database retrieval system