KEGG   Halorhodospira halophila: Hhal_0473Help
Entry
Hhal_0473         CDS       T00462                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hha  Halorhodospira halophila
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:hha00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hhal_0473
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Hhal_0473
Enzymes [BR:hha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Hhal_0473
Two-component system [BR:hha02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Hhal_0473
Bacterial motility proteins [BR:hha02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Hhal_0473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(540937..542124)
Genome map
AA seq 395 aa AA seqDB search
MSIRVLVVDDSGFFRRRIRAMVEQDPRLEVCGEAADGRQAVSLAQRLCPDVITMDIEMPE
LDGISAVREIMQRRPTPVLMFSSLTHEGARATIEALEAGAADFIPKRFADISGDMEAVQR
QLCGRLVELGGGRRGGGPRGGQAAVSQARAPAAAPPATGEAPTPSRTPPAARSRPEGEAA
ARAPAPAAQPAPATGARRAGRGGPRLADLQAVVIGCSTGGPVALQRVLTRLPASFPVPVL
VIQHMPASFTPAFAERLNELCQVQVREADDDDLLRPGEVLLAPGGRHLGVRGRSGALSVY
TYEGQSDHHYKPSVDIAFSELARLAPAGVLGIVLTGMGSDGAKGAKLLKDNGCWVWSQDE
ASSVIYGMPAAVAKAGLSDQVLPLERIGDELARLR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgagcattcgggttctggtggtcgacgattccggtttcttccgccggcgcatccgcgcc
atggtcgagcaggacccgcgtctcgaggtctgcggcgaggctgccgacggccgacaggcc
gtgtcgctggcccagcggctgtgcccggacgtgatcaccatggacatcgagatgcccgaa
ctcgacggcatctcggcggtccgcgagatcatgcagcgccgacccaccccggtgctgatg
ttctcctcgctcacccacgagggggctcgggcgaccatcgaggcgcttgaagccggcgcc
gccgatttcatccccaagcggttcgccgacatctccggcgacatggaggcggtccagcgt
cagctctgcgggcggctggtcgagctcggcggcggccggcgcgggggtggcccccggggc
gggcaggctgcggtttcccaggcccgggcgccggcggctgcgcctccggctaccggcgag
gccccgacgcccagccgcaccccgccggcggctcgctcacgcccggaaggcgaagccgcg
gcgcgggcgccggcccctgcagcgcagccggccccggccactggggcgcggcgcgccggc
cgcggcggtccgcgcctggccgatctgcaggcggtggtcatcgggtgctccaccggcggg
ccggtggcgctgcagcgggtgctgacccggctaccggcgagcttcccggtgcccgtgctg
gtgatccagcatatgccggcctccttcaccccggccttcgccgagcgcctcaatgagctc
tgccaggtgcaggtccgcgaggcggatgacgacgacctgctgcgccctggcgaggtgctc
ctcgcccccggcggccggcacctgggggtacgcgggcgcagcggcgcgctcagtgtctac
acctatgaggggcagagcgaccaccactacaagccgagcgtcgatattgccttcagcgag
ctggcccggctggccccggcaggggtgctggggatcgtgctcactggtatgggctcggac
ggggccaagggggccaagctgctcaaggacaacggttgctgggtgtggagccaggacgag
gcgagcagcgtcatctacggcatgccagcggcggtggccaaggccgggctcagtgatcag
gtgctgcccctcgagcggatcggagacgaactcgcccgccttcgctag

DBGET integrated database retrieval system