KEGG   Halorhodospira halophila: Hhal_0941Help
Entry
Hhal_0941         CDS       T00462                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hha  Halorhodospira halophila
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hha00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hha00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1017962..1018948
Genome map
AA seq 328 aa AA seqDB search
MSVQLDPQGQLRHLVTTEGLPRELLTRILDTAESFSGVLGKSVKKVPLLRGRTIINLFFE
PSTRTRTTFELAAQRLSADVLNIDVATSSTSKGESLLDMLRNLEAMQCDAFVVRHADSGA
AEFIARHVAPGVAVINAGDGRHAHPTQALLDAFTIRREKGPLEPLTIAIVGDILHSRVAR
SQIHALLGLGAGEVRVIGPRTLLPRDIQRLGVRVYEDMDAGLDGADVLIMLRLQRERMRG
ALLPSESEYFSRYGLTEQRLERTHPEAIVMHPGPVNRGVELDPQVADGPRSVILRQVTNG
IAVRMAVMSIVLGGHGEAPAEPIEEASS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgcaactcgacccccaggggcagctgcgccacctggttaccaccgaggggctg
ccccgcgagctgctgacccgcatcctcgataccgccgagtcgttctccggggtccttggc
aagtcggtgaagaaggtgccgctgctgcgcggacggaccatcatcaacctcttctttgag
ccgagtacccgcacccgcaccaccttcgagctggccgcccagcggctctcggccgacgtg
ctcaacatcgacgtcgccacctcctccaccagcaagggggagagcctgctggacatgctg
cgcaatctcgaggcgatgcagtgcgacgccttcgtggtccgccacgccgacagtggcgcc
gccgaattcatcgcccgccacgtcgcccccggggtggcggtgatcaacgccggcgacggg
cgccacgcccaccccacccaggcgctgcttgacgccttcaccatccgccgcgagaagggc
cccctggagccgctgaccatcgccattgtcggcgatatcctccactcgcgggtggcccgc
tcgcagatccacgccctgctcggcctcggcgccggcgaggtgcgggtgatcgggccgcgc
acgctgctgccgcgggatatccagcgcctgggcgtgcgggtctatgaggacatggatgcc
gggctcgacggcgccgacgtgctgatcatgctccgcctccagcgcgagcgcatgcgcggc
gccttgctaccgagcgagagcgagtacttctcgcgctacggtctgaccgaacaacgcctg
gagcgcacccacccggaggccatcgtcatgcacccgggtccggtcaaccggggcgtcgaa
ctcgatccgcaggtggccgacggtccccgctcggtgatcctgcgccaggtcaccaacggt
atcgcggtgcgcatggcggtcatgtccatcgtcctgggcgggcacggcgaggcgcccgcg
gaaccgatcgaggaggcgtcgagttga

DBGET integrated database retrieval system