KEGG   Halorhodospira halophila: Hhal_1036Help
Entry
Hhal_1036         CDS       T00462                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hha  Halorhodospira halophila
Pathway
hha00010  Glycolysis / Gluconeogenesis
hha00020  Citrate cycle (TCA cycle)
hha00620  Pyruvate metabolism
hha01100  Metabolic pathways
hha01110  Biosynthesis of secondary metabolites
hha01120  Microbial metabolism in diverse environments
hha01130  Biosynthesis of antibiotics
hha01200  Carbon metabolism
Module
hha_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hhal_1036
   00020 Citrate cycle (TCA cycle)
    Hhal_1036
   00620 Pyruvate metabolism
    Hhal_1036
Enzymes [BR:hha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Hhal_1036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H CAT
Motif
Other DBs
NCBI-ProteinID: ABM61812
JGI: Hhal1036
UniProt: A1WVV0
Position
complement(1116889..1118259)
Genome map
AA seq 456 aa AA seqDB search
MAEQELKVPDIGGFEEVEVIEVLVAPGDRIEAEQSLITLESDKASMEVPAEVGGEIRAVH
VAVGDTVSEGSVVATVDPVAEPAEPATQAEAPAAAGGPAEETAPSADGGAPATAAPAAAA
QPAASAGSGGGAAAGGVDESPAIDRDGHRAAHASPSVRRYARELGVDLSRVQGSGRKGRI
RREDVEAYVKQVMQGQEAPPAGAAGAPAAEGAGIPPIPEQDFSRFGEVERVPLTRIQRLS
GPHLHRSWLNVPHVTQFDEADITEMEAFRQSLKKEAEARGVKLTPLAFLVRAAAAALAEY
PRFNASLSADGQELILKHYCHIGVAVDTPEGLVVPVLRDADQKGVLQIAEDLGTLSAKAR
DGKLGPADMQGGCFSISSLGGIGGTAFTPIVNAPEVAILGVSRSQTRPVWDGQTFQPRLM
LPLSLSYDHRVIDGAMAARFTNYLSQVLGDLRRLVL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtggcggaacaggagctcaaggtaccggatatcggcggcttcgaggaggtggaggtcatc
gaggtcctggttgcgcccggcgaccggatcgaggccgagcagtcgctgatcacactggag
tccgacaaggcgagcatggaggtgccggccgaggtcgggggcgagatccgagcggtgcat
gtggccgtgggggataccgtctccgaggggagtgtcgttgccaccgttgatcctgtcgcc
gagccggcggaaccggcgacgcaggccgaggccccggccgccgcgggtggcccggcggag
gaaacggccccgtcggccgatggcggcgcgccagcgaccgcggcccccgccgccgcggcg
caaccggctgcctccgcgggcagtggcgggggcgctgcagccggaggtgtcgacgagtcg
ccggcgatcgaccgcgacggccatcgcgccgcccacgccagcccctcggtacgccgctac
gcccgcgagctcggggtcgatctctcccgcgtgcagggcagcgggcgtaaggggcgcatc
cgccgtgaggacgtggaggcctacgtcaagcaggtgatgcagggccaggaggcgccgccg
gctggcgccgccggtgcccccgctgccgaaggggccggcatcccgccgatcccggagcag
gacttcagccgcttcggcgaggtggagcgcgtgccgctcacccgtatccagcgcctctcg
gggccgcacctgcaccggagctggctgaatgtcccgcacgtgacccagttcgacgaggcc
gatatcaccgagatggaggcgttccgccaatctctcaagaaggaggccgaggcgcggggg
gtgaagctgaccccgctggccttcctggtccgggcggcggccgccgccctggcggagtat
ccgcgttttaacgccagcctttcggcggacgggcaggagctgatcctcaagcactactgc
cacatcggcgtcgccgtcgacaccccggaggggctggtggtgccggtgctgcgtgacgcc
gaccagaaaggcgtcctgcagatcgccgaggacctcggcaccctctcggccaaggcccgg
gacggcaagctcggtccggcggacatgcagggcggctgcttctccatctcgagcctcggt
ggtatcggcggtaccgcgttcacgcccattgtcaacgctccggaagtggccatcctcggt
gtctcccggtcgcagacccggccggtgtgggatgggcagaccttccagccgcggctgatg
ctcccgctgtcgctctcctacgaccaccgggtcatcgatggcgccatggctgcccgcttc
accaactacctgagccaggtcctcggcgacctgcgccggctggtgttgtag

DBGET integrated database retrieval system