KEGG   Halorhodospira halophila: Hhal_1085Help
Entry
Hhal_1085         CDS       T00462                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hha  Halorhodospira halophila
Pathway
hha00020  Citrate cycle (TCA cycle)
hha00310  Lysine degradation
hha01100  Metabolic pathways
hha01110  Biosynthesis of secondary metabolites
hha01120  Microbial metabolism in diverse environments
hha01130  Biosynthesis of antibiotics
hha01200  Carbon metabolism
Module
hha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hhal_1085
  Amino acid metabolism
   00310 Lysine degradation
    Hhal_1085
Enzymes [BR:hha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Hhal_1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ABM61861
JGI: Hhal1085
UniProt: A1WVZ9
Position
complement(1178835..1180124)
Genome map
AA seq 429 aa AA seqDB search
MSVEIKVPALPESVSEATVVAWHKQPGEAVTQDQNLVDLETDKVVLEVPAPADGVLEAID
RAVGDTVTPDDVLGRVEAGAAPAAEVASAAAAGGQASAESAPGSAGDAASGAAPPAAEAP
APAASLDGLSPAVRRLVREHGLDPAQIESSSGDGRLTKEDVLRHLERRAEAEAAPTAATA
PQSAPAEESAAAAPLGGRPEQRVPMTRLRQRIAERLVEAQQNAAMLTTFNEVNMQPVMDL
RARYRERFEKAHDVRLGFMSFFVKAAVEALKRYPAVNASIDGQDIIYHGYYDIGIAVSSP
RGLVVPVLRDADRLSFAEIEAQINELGKRAQQGKLSMDELTGGTFTVTNGGIFGSLLSTP
IINPPQSGILGMHKIQERPVVEDGEIVVRPMMYLAHTYDHRLIDGREAVQFLVTIKDCIE
DPARLLLEV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgagatcaaggttccagcgctgcccgagtccgtcagtgaggcgacagtggtg
gcctggcacaaacagcccggggaggcggtgacccaggaccagaacctggtcgacctggag
accgataaggttgtcctggaggtcccggcccccgccgacggtgtgctggaggcgatcgac
cgggccgtgggcgatacggtgacgccggacgacgtcctcggccgtgtcgaggcgggtgcg
gccccggcggccgaggtcgcctcggcggcagccgcgggcggacaggcgtcggcggagtcg
gccccggggagcgccggtgacgcggcctccggcgcggccccgccggcggcggaggccccg
gctccagcagccagcctggatggtctgagcccggcggtgcgccgactggtccgcgagcac
gggctcgatccggcgcagatcgaatcgtccagtggggacgggcgcctgaccaaggaggac
gtcctgcgccacctggagcgtcgcgccgaggccgaggcggcgcccacagcggctacagcg
ccgcagagcgctcccgccgaggagtccgccgcagccgcccccctgggggggcggcccgag
cagcgggtaccgatgacccgcctgcgccagcgcatcgccgagcggctggtcgaggcgcag
cagaacgcggccatgctcaccaccttcaacgaggtgaacatgcagccggtgatggatctg
cgcgcccgttaccgcgagcgcttcgaaaaggcccacgacgtgcgcctgggttttatgtcg
ttcttcgtcaaggcggcggtggaggccctcaagcgctacccggcggtcaatgcctccatc
gatgggcaggacatcatctaccacgggtattacgacatcggcatcgccgtctcctcgccg
cgcggcctggtggtgccggtgctccgcgatgccgatcgcctctccttcgccgagatcgag
gcgcagatcaacgagctcggcaagcgcgcccagcagggcaagctgagcatggacgagctc
accggcgggaccttcaccgttaccaacggcggcatcttcggctcgctgctctccacgccg
atcatcaacccgccgcagagcggcatcctggggatgcacaagatccaggaacggccggtg
gtcgaagacggtgagatcgtggtccggccgatgatgtacctggcccacacctacgaccat
cgcctcatcgacggccgggaagccgtgcagttcctggtgaccatcaaggactgcatcgag
gatcccgcccgcctgctgctcgaggtctag

DBGET integrated database retrieval system