KEGG   Halorhodospira halophila: Hhal_1105Help
Entry
Hhal_1105         CDS       T00462                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hha  Halorhodospira halophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Hhal_1105
Enzymes [BR:hha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Hhal_1105
Exosome [BR:hha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hhal_1105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1199010..1201256)
Genome map
AA seq 748 aa AA seqDB search
MGGPSGASGTAAAPERRSGLNRVSQQRAEAEERQRIAEGRHSDPFAYLGGPHGPSRRVRI
YHPEAAAVAFSEGTEVPRVAGTDFFEAPLPEALEAPYQVCWRDAGGAWHTAYDPYAFPPV
LSEFDLHLYAEGRHWHAQRFLGAHCTTVDGVAGVVFSVWAPNAERVSVVGDFNRWDGRRH
PMRLRLEAGVWELFIPGVEPGALYKFELRGAGGCGPLLKTDPCGRRYQHRPETAAVVEPP
EAYPWGDDAWMERRRREGSAWQQAPWSIYEVHLGSWQRDVGGGFLDYRTLAHELVDYVQR
TGFTHIELLPITEHPLDDSWGYQATGYFAPTSRFGEPDAFRYFVDYCHRHGIGVILDWVP
AHFPRDAWALARFDGTPLYEHADPRQGEHRDWGTLIFNFGRNEVRSFLLSSALYWLEAYH
LDGLRVDAVASMLYLNYSREDGDWVPNIHGGNENLEAIAFLREVNTVTHGEQPGTCIIAE
ESTSWPQVTRPTYLGGLGFTMKWNMGWMHDTLTYLGEDPVHRRYHHDQLTFGLLYAFTEN
FVLPFSHDEVVHGKGSLLDRMPGDDWQRLANLRLLYAYQFTYPGKKLLFMGCEIGQRSEW
DADATVDWAALSDPRHAGVQRLVSDLNALYRGVPALHRYDFAEAGFAWVDCHDAEQSVLS
YLRRGDAGEQALVVLNFTPVPRHGHRLGVPAPGRWTERMNTDSAYYGGSDLGNAGGVLAE
PVPWSGYPYSVTLTLPPLAGLVLVGEGA
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcccatccggggcgagcggcaccgcagcggcgcctgagcggaggtcaggcttg
aatcgcgttagccaacagcgcgccgaggccgaagagcgccagcggatcgccgaggggcgc
cactcggatcccttcgcctacctcggcggcccccacggcccgagccggcgggtgcgcatc
taccacccggaggcggcggcagtggcctttagcgagggcaccgaggtgccgcgcgttgcc
ggcaccgacttcttcgaggcgccgctgcccgaggcccttgaggcgccgtaccaggtctgc
tggcgggatgccgggggtgcctggcacaccgcctacgacccttacgccttcccgccggtg
ctctcggagttcgacctgcacctctacgccgaggggcggcactggcacgctcagcgcttc
ctgggggcgcactgcaccacggttgacggggtggcaggcgtggtcttttcggtttgggcg
cccaacgccgagcgggtcagcgtggtgggggatttcaatcgctgggatgggcgccgccac
cccatgcgcctgcgcctggaggccggggtctgggagctgtttatccccggggtggagccg
ggggccctgtacaagtttgagctgcggggagccggcggctgcgggccgctgctcaagacc
gacccctgtggccggcgctaccagcaccggcccgagaccgccgccgtggtggagccgccc
gaggcctacccctggggggatgatgcgtggatggagcgccgccggcgcgaggggagcgcc
tggcagcaggcaccgtggtcgatctacgaggtgcatctgggctcctggcagcgggatgtc
gggggggggttcctcgactaccgcaccctggcccacgagctggtcgactacgtccagcgc
acgggcttcacccacatcgagctgctgccgatcactgagcacccgttggacgactcctgg
gggtatcaggccaccggctacttcgccccgaccagtcggttcggcgagccggacgcgttt
cgctacttcgtggactactgccaccgccacggtatcggcgtgatcctggactgggtaccg
gctcactttccccgggacgcatgggccctggcccgtttcgacggtacgccgctctacgag
cacgctgatccccggcagggcgagcaccgcgactgggggacgctgatcttcaacttcggt
cgtaacgaggtgcgcagcttcctgctctccagcgccctctactggctggaggcctaccac
ctggacgggctccgggtggatgcggtcgcctcgatgctctacctgaactactcccgcgaa
gacggggactgggtgccgaacatccacggcggcaacgagaacctggaggccattgccttc
ctgcgcgaggtgaacaccgtcacccacggcgagcagccggggacctgcatcatcgccgag
gagtccacctcctggccccaggtcacgcggcccacctacctcggtgggttggggttcacc
atgaagtggaacatgggctggatgcacgacaccctgacctacctcggcgaggaccccgtc
catcgccgctaccaccacgaccagctgaccttcggcctgctctacgcctttaccgagaac
ttcgtcctgccgttcagtcacgacgaggtggtccacggcaagggcagcctgctcgaccgc
atgcccggcgacgactggcagcgcctggcgaacctgcgcctgctctacgcctaccagttc
acctacccgggcaagaagctgctgttcatgggctgcgagatcggccagcgcagcgagtgg
gacgccgatgccacggtggactgggcggccctgtccgacccgcgccacgccggcgtgcag
cgtctggtcagtgatctcaatgcgctctaccgtggcgtgccggccctccaccgctacgac
ttcgccgaggcgggtttcgcctgggtggattgccacgacgccgagcagtcggtactcagc
tacctgcgccgcggcgatgccggggagcaggcgctggtggtcctgaactttacgccggtc
ccccgccacggccaccggctgggcgtgccggcccccgggcgctggacagagcggatgaac
accgactcggcttactacggcggatcggacctgggcaatgccggcggtgtgctcgccgag
ccggtgccgtggagtggctacccctactcagtgaccctgaccctgccaccgctggccggc
ctggtgctggtcggggagggggcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system