KEGG   Halorhodospira halophila: Hhal_1108Help
Entry
Hhal_1108         CDS       T00462                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hha  Halorhodospira halophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Hhal_1108
Enzymes [BR:hha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Hhal_1108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1204329..1205822
Genome map
AA seq 497 aa AA seqDB search
MSGAGLSERRRAGVLLHVSALPGPGGNGDLGHHAYRFVDWLAEAGFTIWQMLPLGPTHDD
LSPYQGLSVHAGEPCYIDLHTLVELGWLTPEEIQPPETGDDPVALRAWRRSCLGRARQRL
RDRNDATTEAQIAAFRQAHGHWLEDYALYAALREEHDLLPWWQWPTAERDREPAALEAAA
TRLADRIDQQVFEQYLFFTQWQALRHYAAERGVRFFGDIPIFVAHDSADTWARRACFRLD
SEGQAAVVAGVPPDYFSAEGQRWGNPLYDWQQLQADGFGWWLERLATQLALFDFVRIDHF
RGLSACWTIPAEAPTARDGYWEATPGDALLEAVQERFGRVPLVAEDLGVITEDVERLRDR
FALPGMKVLHFAFDSDAANPYLPHHHHRHSVVYTGTHDNNTTVGWYAGLAPETVERVHAY
LGYPTEPMPWPLTRAALASVASVAVIPLQDLLELDGEHRMNVPGTTEGNWRWRFAWEWLP
DSLAGQLYDLNRLYGRL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcgcgggactgtccgagcggcgccgcgccggcgtgctgctgcacgtcagcgca
ctgcccgggcccgggggcaacggcgacctggggcaccacgcctaccgcttcgtggactgg
ctcgccgaggccggcttcacgatctggcagatgctgccgctgggccccacccacgacgac
ctcagcccctatcaaggcctgtcggtgcacgccggtgagccgtgctacatcgacctgcac
acgctggtcgaactcggctggttgacccccgaggagatccagcccccggagaccggcgac
gaccccgtcgcgctgcgggcgtggcgccgctcctgccttggccgcgcccgacaacgcctg
cgcgatcgcaacgacgcaacgaccgaggctcagatcgccgccttccgccaggcgcacggc
cactggctggaagactacgccctctacgcggcgctgcgcgaggagcatgacctcctgccc
tggtggcagtggcccaccgccgaacgcgatcgggaaccggcggcgctggaggcggcagcc
acccgcctggccgaccggatcgaccagcaggtcttcgagcagtacctgttcttcacccag
tggcaggcgctgcgccactacgccgcggaacgcggcgtccggttcttcggcgacatcccc
atcttcgtcgcccacgacagcgccgacacctgggcccggcgggcctgcttccgactcgac
agcgaggggcaggcagcggtggtggccggcgtcccaccggactacttctcggccgagggg
cagcgctggggcaaccccctctacgactggcagcagctgcaggccgatggcttcggctgg
tggctcgagcgcctggccacacagttggcactgttcgacttcgtgcgcatcgaccacttc
cgtggcctgagcgcctgctggaccatccccgccgaggcccccacggcccgggacgggtac
tgggaagcgacccccggagacgctctgctcgaggccgttcaggaacgcttcgggcgggtc
ccgctggtcgccgaggacctaggggtgatcaccgaggacgtggagcgcctgcgcgaccgc
ttcgccctgccggggatgaaggtcctccacttcgccttcgacagcgacgccgccaacccc
tacctgccgcaccaccaccaccgccacagtgtggtctacaccggtacccacgataacaac
accaccgtgggatggtacgccggtctcgcgccggagaccgtggagcgggtccacgcgtac
ctgggctacccgaccgagccgatgccctggcccctgactcgagccgccctggcctcggtg
gcgagcgtggccgtcatccccctacaggacctgctcgagctggacggcgaacaccgcatg
aacgtccccggcaccaccgaaggcaactggcgctggcgctttgcttgggagtggctgccc
gactccctggccgggcagctgtacgacctcaaccggctctacggccggctctag

DBGET integrated database retrieval system