KEGG   Halorhodospira halophila: Hhal_1119Help
Entry
Hhal_1119         CDS       T00462                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hha  Halorhodospira halophila
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hhal_1119
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hhal_1119
   00052 Galactose metabolism
    Hhal_1119
   00500 Starch and sucrose metabolism
    Hhal_1119
   00520 Amino sugar and nucleotide sugar metabolism
    Hhal_1119
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hhal_1119
   00524 Butirosin and neomycin biosynthesis
    Hhal_1119
Enzymes [BR:hha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Hhal_1119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1215103..1216044)
Genome map
AA seq 313 aa AA seqDB search
MTRYLLADIGGTHTRIATAGPGEAPGTATRYRNRDLSGPTEALQRHCATHDGDEWWVAAA
VAGPVADGRVQLTNLGWQVEADELARRTGAVRAELVNDYQALARALPELQPAEHCALLRS
GTPVTGTPMAVLGPGTGLGVSGVVPAAQGWGVIAGEGGHVTLAAADETEAALLAALREEL
GHVSAESVLSGAGLSRLHRLLHGVEASPEAITAADQEADPAARETFDRFLGFLGGTAGNL
ALTLGARAGVFLAGGILPRLAASRLTTSPLLERFLAKGRFRAYLEPVPVQRIDDPAAAAL
LGLRAWLDDLRYP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgttacctgctggccgatatcggcggcacgcacacccgcatcgcaacggccggg
ccgggcgaggcgccggggacggcgacgcggtaccgcaatcgggacctctccggccccacc
gaagcgctgcagcgtcactgcgcgacgcacgacggtgacgagtggtgggtggccgcggcg
gttgccgggccggtggccgatgggcgcgtgcagctgaccaatctcggttggcaggtcgag
gccgacgagctggcacgacggaccggtgcggtccgcgccgagctggtcaacgactaccag
gccctggcccgggccttgcccgagttgcagccggccgagcactgcgcgctgctgcgctcc
ggcacgccggttacgggtacgccgatggcggtgctcggtccggggaccggcctgggggtc
tccggcgtggtgccggccgcgcagggttggggggtgattgctggcgagggcggtcacgtc
accctggccgccgccgatgagaccgaggcggcgttgctcgccgctctgcgcgaggaactc
ggccacgtttccgctgagtcggtgctcagcggtgccgggctgagccgcctccatcggctg
ttgcacggggtcgaggcgtctccggaggccatcaccgccgccgatcaggaggccgatccg
gccgcccgggagaccttcgaccgcttcctcgggttcctcggcgggacggccggcaatctg
gccctgaccctgggcgcgcgtgccggggtcttcctggccggggggatcttgccgcgcctg
gccgcgtcgcggctcacaacctcgccgctgctcgagcgcttcttggcgaaggggcgtttc
cgtgcctatctggagccagtgccggtgcagcggatcgacgatccggcggcggccgcgctg
ctcggcctgcgggcgtggctcgatgacttgcggtacccttga

DBGET integrated database retrieval system