KEGG   Halorhodospira halophila: Hhal_1261Help
Entry
Hhal_1261         CDS       T00462                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hha  Halorhodospira halophila
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Hhal_1261
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Hhal_1261
Enzymes [BR:hha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Hhal_1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1368955..1369995)
Genome map
AA seq 346 aa AA seqDB search
MLGPLMIGIAGGELPAQARELLRHPAVGGVVLFTRNFKNTQQLHDLTQSIHAVREPPLLV
AVDQEGGRVQRFREGFTPLPAASWFGRLYDLDPDQARQSAHRAGWVMAAELRACGVDLSF
APVLDLDGGVSHVIGSRALHREPAAVARLGHAWMRGMRQAGMAAVGKHFPGHGSVEADSH
VALPCDDRSLAEIARRDLVPFQRLAASGLPGVMAAHLVVPDVDDRPAGFSPRWIGDILRR
RVGFLGAVFSDDLGMRGAETAGTMFDRVDACLGAGCDVALVCDPAEAEALLGEASGDRWL
DPTSALRLVRMHGRPAPGWPELRADGAYQTAVCELTEGVPGFGAPG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcccgctcatgattggaatcgcggggggtgaactcccagcgcaggcgcgagag
ctcctgcggcatccggccgtcggtggggtcgttctcttcacgcgtaactttaaaaatacg
cagcagcttcatgatctgacacagtccattcacgccgtgcgtgagccgcccctgctggtc
gctgtcgatcaggagggcggccgcgtgcagcgctttcgggagggcttcaccccgctgccc
gccgcttcctggttcggtcgattgtacgatctcgatcccgatcaggcccggcagagtgcg
caccgggcggggtgggtgatggccgcggaactgcgcgcctgcggggtggatctgagtttc
gcgccggttttggatctcgatgggggggtgagccacgtgatcggttctcgcgccctgcac
cgtgagccggccgcggtggcgcggctcggtcacgcctggatgcgcggcatgcgtcaggcg
gggatggcggcggtaggcaagcacttcccggggcacggttcggtcgaggccgacagccac
gtggccttgccctgcgatgaccgttcactggcagagatcgcgcgtcgggatctggtaccc
tttcagcgcttggcggcctcgggactcccaggggtcatggctgcgcacctggtcgtcccc
gatgtcgacgaccggccggccggtttctccccacgctggatcggtgacatcctgcgccgc
cgggtcggcttcctcggtgcggtcttcagtgatgacctcggcatgcgcggggcggagacc
gccggtaccatgttcgaccgggtggatgcgtgcctgggggcgggctgcgatgtggcgctg
gtctgcgatccggccgaggccgaggcgctgctcggcgaggcgtccggggatcgctggctg
gatcccacgtcggcgctgcgtctggtacgcatgcacggccgaccggcgcccgggtggccc
gagttacgggcggacggcgcctaccagacagcggtctgcgaattgaccgagggcgttccc
gggttcggggcgccggggtga

DBGET integrated database retrieval system