KEGG   Halorhodospira halophila: Hhal_1264Help
Entry
Hhal_1264         CDS       T00462                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hha  Halorhodospira halophila
Pathway
hha00010  Glycolysis / Gluconeogenesis
hha00260  Glycine, serine and threonine metabolism
hha00680  Methane metabolism
hha01100  Metabolic pathways
hha01110  Biosynthesis of secondary metabolites
hha01120  Microbial metabolism in diverse environments
hha01130  Biosynthesis of antibiotics
hha01200  Carbon metabolism
hha01230  Biosynthesis of amino acids
Module
hha_M00002  Glycolysis, core module involving three-carbon compounds
hha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hhal_1264
  Energy metabolism
   00680 Methane metabolism
    Hhal_1264
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hhal_1264
Enzymes [BR:hha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Hhal_1264
Membrane trafficking [BR:hha04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Hhal_1264
Exosome [BR:hha04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Hhal_1264
  Exosomal proteins of melanoma cells
   Hhal_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Phage_P2_GpE
Motif
Other DBs
NCBI-ProteinID: ABM62039
JGI: Hhal1264
UniProt: A1WWH7
Position
1371162..1371854
Genome map
AA seq 230 aa AA seqDB search
MPKLVLLRHGQSIWNLENRFTGWYDVDLSDQGINEAREAGVALREAGIAPQVAYTSVLKR
AIRTLWLSLAELDRMWIPEIKDWRLNERHYGALTGLNKAETAEQYGDEQVHIWRRSYDTP
PPALDAEDERHPRHDPRYAGLDPQQLPGTESLKLTLERVLPCWEGEIAPALRQHDCVLIA
AHGNSLRALVKHLDGLADDAIMKVEIPTGRPLVYELAEDLSVQRSYYVQD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaactcgtcttactgcgtcacggtcagagcatctggaacctggaaaaccggttc
actggctggtacgacgtcgacctaagcgaccaggggatcaacgaagcccgcgaggccggt
gtcgccctgcgcgaggcgggcatcgctccgcaggtcgcctacacgtcggtgctcaagcgg
gccattcgcaccctctggctgagcctcgccgaactcgaccgcatgtggatccccgagatc
aaggactggcggctcaacgagcgccactacggcgcactcactggcctgaacaaggcggag
acggccgagcagtacggcgacgagcaggtccacatctggcggcgcagctacgatacgccg
cccccggcactcgatgccgaggacgagcgtcacccgcgccacgatccgcgctacgccggc
ctagacccgcaacagctgccaggtacggaatcgctcaagctgaccctggagcgcgtgctg
ccctgctgggagggggaaatcgcgccggccctccggcagcacgactgcgtgctgattgcc
gcccacggcaacagcctgcgcgcgctggtcaagcacctcgacggtctggccgacgatgcc
atcatgaaggtggagatccccaccggccgccccctggtctacgaactggccgaggacctg
agcgtgcagcgcagctactacgtgcaggactga

DBGET integrated database retrieval system