KEGG   Halorhodospira halophila: Hhal_1264Help
Entry
Hhal_1264         CDS       T00462                                 

Definition
(GenBank) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hha  Halorhodospira halophila
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hhal_1264
   01230 Biosynthesis of amino acids
    Hhal_1264
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hhal_1264
  Energy metabolism
   00680 Methane metabolism
    Hhal_1264
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hhal_1264
Enzymes [BR:hha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Hhal_1264
Exosome [BR:hha04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Hhal_1264
  Exosomal proteins of melanoma cells
   Hhal_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1371162..1371854
Genome map
AA seq 230 aa AA seqDB search
MPKLVLLRHGQSIWNLENRFTGWYDVDLSDQGINEAREAGVALREAGIAPQVAYTSVLKR
AIRTLWLSLAELDRMWIPEIKDWRLNERHYGALTGLNKAETAEQYGDEQVHIWRRSYDTP
PPALDAEDERHPRHDPRYAGLDPQQLPGTESLKLTLERVLPCWEGEIAPALRQHDCVLIA
AHGNSLRALVKHLDGLADDAIMKVEIPTGRPLVYELAEDLSVQRSYYVQD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaactcgtcttactgcgtcacggtcagagcatctggaacctggaaaaccggttc
actggctggtacgacgtcgacctaagcgaccaggggatcaacgaagcccgcgaggccggt
gtcgccctgcgcgaggcgggcatcgctccgcaggtcgcctacacgtcggtgctcaagcgg
gccattcgcaccctctggctgagcctcgccgaactcgaccgcatgtggatccccgagatc
aaggactggcggctcaacgagcgccactacggcgcactcactggcctgaacaaggcggag
acggccgagcagtacggcgacgagcaggtccacatctggcggcgcagctacgatacgccg
cccccggcactcgatgccgaggacgagcgtcacccgcgccacgatccgcgctacgccggc
ctagacccgcaacagctgccaggtacggaatcgctcaagctgaccctggagcgcgtgctg
ccctgctgggagggggaaatcgcgccggccctccggcagcacgactgcgtgctgattgcc
gcccacggcaacagcctgcgcgcgctggtcaagcacctcgacggtctggccgacgatgcc
atcatgaaggtggagatccccaccggccgccccctggtctacgaactggccgaggacctg
agcgtgcagcgcagctactacgtgcaggactga

DBGET integrated database retrieval system