KEGG   Halorhodospira halophila: Hhal_1269Help
Entry
Hhal_1269         CDS       T00462                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hha  Halorhodospira halophila
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hha00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Hhal_1269
Enzymes [BR:hha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Hhal_1269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1376249..1378291)
Genome map
AA seq 680 aa AA seqDB search
MSVRVDQEAILRWLREAEALGWLRPLDGALAEFLREQVPDAPPLLLLAAALTSHQAGRGH
VCLDLDQLWERAEPVLSLPPETVDAPEPVKSPAALLDAAGGRDAFERQLECPELVGRGPG
STPLVRDGPRLYLRRYWACERTIARVVQQRVDAAAQWRAQLDPATVRRWLDGLFGAPGGD
GPDWQRVACAVAAGSGFSVITGGPGTGKTTTVLRLLALLQGLHGGALRIRLTAPTGKAAA
RLNASIAGAVDRLGLEELDGGAELRARIPTEVVTVHRLLGAGGGRRFRHHAGEPLAADVV
VVDEASMIDVELMAALLEALPDGGRLVLLGDKDQLASVEAGAILGELCARADQGGYWPDT
AEWLEAVSGQCIPSALIDPTGGGLDQHVVMLRHSHRFGADSGIGRLARAVNAGDQAAVEA
WGYGHEGDLARVQLADGEQDPTLIHWAVDGGQTGLGYAAYLSDIQELRPGPDASAGEYAG
WASQVLETHGAFQLLAALRRGPYGVEALNERLAAALRQRGLIRGEGAWYEGRPVIVTRND
YGLGLINGDIGIALRVPRFLVQSPEAGGAGEERQKVLRVAFRAADGSGRIRWVPPHRLES
VETAFALTVHKAQGSEFRHAALLLPDRPSPVLTRELLYTGITRASQWFTLLEPQPAVLKA
AVRQRTVRGGGLRAMLEAAG
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgcgggtcgatcaggaggcgatcctcaggtggctgcgtgaggccgaggcgctg
ggctggctgcgcccgttggatggggccctggcggagttcctgcgtgagcaggtgcccgat
gcgccgccgctgctgttgctggccgcagcgctgaccagtcatcaggcgggccgtgggcat
gtctgcctggatctcgatcagctctgggaacgggccgagccggtcctgagccttccgccg
gagaccgttgacgcgcccgagccggtgaaatcgcccgcggcactcctggacgccgccggc
ggtcgcgatgcgttcgagcggcaattggagtgcccggaactggtgggcagaggccccggt
tccacaccgctggtccgcgacggaccgaggctctatctgcgccgctactgggcctgcgag
cgcaccatcgcacgggtggtgcagcagcgcgtggatgcagcggcgcagtggcgcgcgcag
ctcgacccggccacggtccggcgctggctggatgggttgttcggcgcgcctgggggcgat
ggcccggattggcagcgggtcgcctgtgccgtggccgccggcagtggtttcagtgttatc
accggcggaccgggtaccggcaagactacgacggtgttgcgtctgctggcgttgctgcag
gggctccacggcggggccctgcgcatccgcctgacggcccccaccggcaaggcggcggca
cggctgaacgcgagcatcgccggggcggtggatcggctggggctggaggagctggacggc
ggcgccgagctgcgcgcgcggatacccaccgaggtggtgacagtgcaccggctgctgggc
gcaggcggtggacggcgctttcgccaccacgccggggaacccctggccgcggatgtggtg
gtcgtggatgaagcgtcgatgatcgacgtggagttgatggcggcgttgctggaggccctg
ccggatgggggccgtctggtgctgcttggtgacaaggaccagttggcctcggtggaggcc
ggggccatccttggcgagctctgcgcccgggcagatcagggcggttattggcccgatacc
gccgagtggctagaggcggtcagcggccagtgcatcccgtcggcgctgatcgatcccacc
ggcggtggtctcgaccagcatgtcgtcatgcttcggcacagccaccggttcggtgccgac
agcgggatcgggcgcttggctcgggcggtgaatgccggtgatcaggcggcggtcgaggct
tgggggtatgggcacgagggcgatctggcgcgggtgcagcttgccgacggagagcaagac
ccgacgctgatccactgggcggtggacggcgggcagaccggcctgggctacgccgcttat
ctgagcgacatccaggaactgcgaccgggcccggatgcctccgctggggagtacgccggc
tgggcctcgcaggtgctggagacgcacggggcgttccaattgctggcggcgctgcggcgc
ggaccgtacggggtcgaggccctcaatgagcgccttgccgcggcgctgcgccagcggggg
ctgatccgaggtgagggggcctggtacgagggccgaccggtgatcgtcacgcgcaacgat
tacggcctggggctgatcaacggggatatcggcatcgccctgcgcgtcccgcgcttcctg
gtgcagagcccggaggcggggggtgccggggaggagcgacagaaggtgctgcgtgtcgcc
ttccgcgccgccgatggcagcggacgcatccgctgggtcccgccccatcggctggagtcc
gtggagacggcattcgccttgacggtgcacaaggcccagggttcggagtttcgccacgca
gccttattgctgccggatcggcccagtccggtgctcacccgtgagctcctctacaccggc
atcacccgggccagtcagtggttcaccctgctggagccgcaaccggccgtgctgaaggcg
gcggtgcgccagcgaaccgttcgtggtggcggcctgcgggccatgctcgaggctgctggc
tag

DBGET integrated database retrieval system