KEGG   Halorhodospira halophila: Hhal_1402Help
Entry
Hhal_1402         CDS       T00462                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
hha  Halorhodospira halophila
Pathway
hha00630  Glyoxylate and dicarboxylate metabolism
hha01100  Metabolic pathways
hha01110  Biosynthesis of secondary metabolites
hha01120  Microbial metabolism in diverse environments
hha01200  Carbon metabolism
Module
hha_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Hhal_1402
Enzymes [BR:hha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Hhal_1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABM62169
JGI: Hhal1402
UniProt: A1WWV7
Position
complement(1514973..1516241)
Genome map
AA seq 422 aa AA seqDB search
MLKDQAAIERDWAENPRWKGVQRGYGADEVVRLRGTVHVEYSLARQGAEKLWQSMHEMPY
VNALGALTGNQALQQVKAGLNAIYLSGWQVAADANLGQTMYPDQSLYPANSVPAVVDRIN
NALLRADEINHAEGNPPFDFMKPIVADAEAGFGGVLNAFELMKGMIRAGAAGVHFEDQLA
SVKKCGHMGGKVLLPTQEAVQKLIAARLAADTMDVPTILVARTDAEAADLLTSDVDDNDK
PFITGERTAEGFFRTKPGIEQAISRGLAYAPYADVIWCETGKPDLEFAREFAQAIHEKYP
GKLLAYNCSPSFNWAGNLDEATIRKFQDELGKMGFKFQFITLAGFHSLNYSMFELARGYK
ERQMEAYSELQQAEFAAEKHGYTATRHQREVGAGYFDQVTNVIQGGQSSVTALKGSTEEE
QF
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagatcaagcggcgattgagcgtgactgggcggagaacccgcgctggaaaggg
gtgcagcggggctacggggccgatgaggtcgtccgtctccgggggaccgtgcacgtcgag
tacagcctggcgcgccagggtgcagagaagctgtggcagtccatgcacgagatgccctac
gtcaacgccctcggcgccctgaccggcaaccaggccctgcagcaggtcaaggccgggctc
aacgccatctacctctcgggctggcaggtggccgccgacgccaacctcggtcagaccatg
tatcccgaccagtcgctctacccggcgaactcagtccctgcggtggtcgatcgcatcaac
aacgcgctgctgcgcgccgacgagatcaaccacgccgagggcaacccgccgttcgacttc
atgaagcccatcgtggcggacgccgaggccggtttcggcggcgtgctgaacgcctttgag
ctgatgaaggggatgatccgcgccggtgccgcgggggtccacttcgaggatcagctggct
tcggtgaagaagtgcggccacatgggcggcaaggtgctgctgcccacccaggaggcggtg
cagaagctcatcgctgcgcgcctggcggccgacaccatggatgtgccgaccatcctggtc
gcccgtacggacgccgaggcggcagacctgctgacctccgacgtggacgacaacgacaag
ccgttcattaccggcgagcgcactgcggagggctttttccgcaccaagccgggcatcgag
caggccatcagccgcggcctcgcctacgccccttacgccgacgtgatctggtgcgagacc
ggcaagccggatctcgaattcgcccgcgaattcgcgcaggccattcacgagaagtatccc
ggcaagctgctcgcctacaactgctcgccgtcgttcaattgggcgggcaacctggacgag
gccaccatccgcaagttccaggatgagctcggtaagatgggcttcaagttccagttcatc
acgctggccggcttccactcgctcaactactcgatgttcgagctggcccgcggctacaag
gagcggcagatggaggcgtactccgagctgcagcaggcggagtttgccgcggagaaacac
ggttacaccgcgacccgtcaccagcgggaggtgggcgccggctacttcgaccaggtcacc
aacgtgatccagggcggccagtcctcggtgacagcgctgaaggggtcgacggaggaagag
cagttctaa

DBGET integrated database retrieval system