KEGG   Halorhodospira halophila: Hhal_1635Help
Entry
Hhal_1635         CDS       T00462                                 

Gene name
bchH
Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
hha  Halorhodospira halophila
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hha00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1782484..1786233)
Genome map
AA seq 1249 aa AA seqDB search
MPKPTSVADPTPVRVAIITLDSHMAGAVERARPALQRDIPGLELSYHAASDWNNNPAALE
RARERIASADIIVATMLFMEEHIEPVRQDLEARREDCDALVGIMSAGEVMKLTRMGKFTM
DGSTRGPMSLLKKLRGKKGKAEQQDDDDSTSGEKQAAMLRRIPRILRFIPGTAQDVRAYF
LTWQYFLASSDENVENMVRFLVNRYAAGPRSGLRGSLEVQDPIEYPDVGVYHPRMERRIG
DDPNDLPEPEGGASRGTVGLLLMRSYVLAGDSAHYDGVIEALESRGYRVVPAFASGLDNR
PAVERFFMADGRACVDAVISLTSFSLVGGPAYNNSGAAERLLRRLDVPYLNAQALEFQSL
EQWEGSDRGLTPVETTMMVAIPELDGATGPVVFGGRAAVPGPDGVCRMEVHPERAKMLAS
RVDRLIRLRRSARSERKLSIVIFSFPPEAGALGSAAYLSVFASLYNTLVELDDAGYRVEL
PESVDDLRDRIIKGNAANYGAHANVHHRVTVDDYVAREPYLKEIEEQWGPAPGKAQSDGQ
SIHVLGAQFGNVFIGVQPGFGYEGDPMRLLFEKGLTPTHAMCAFYRYIREDFGADAVLHF
GTHGALEFMPGKQCGMSAGCWPDRLIGDLPNYYLYAANNPSEGSIAKRRSAATLISYLTP
PVGKAGLYKGLLELKASVERYRSAPPDNVEERTELARLIQAQAAEVDLAELEPEWGEEEA
EQRIAQLSEDILEMEYTLIPEGLHVVGQPPSREGRIDQLVTMAETTHGVAVDRACVEALV
DGHSPREALAQSESVDPEMTEEALEGLADTAQKLAENQELQGIIHALDARFVPPVSGGDL
LRSPQILPTGRNMHGFDPYRLPSAFAVQDGARQAERLLDKHREEGQELPDSIAMVLWGTD
NLKSEGAPIGQALYLIGARPRFDSFGKLAGAELIPLDELGRKRIDVVITLSGIFRDLLPL
QTRVLAEAAYLSACAEDEPLEMNPIRRNALAYQEKHGCDFETAALRVFSNADGAYGSNVG
SMIDQGAWEDEDELADTYTRRKCYAYGRSGEPVRQEELLGSMLSGVELTYQNLESVELGV
TTVDHYFDTLGGISRAVARSRGGEHVPVYIGDQTRGEGKVRTLSDQVALETRTRMLNPKW
YEGLLEHGYEGVHQIEVHLTNTMGWSATTGQVQPWVYQQFTQTFMLDDEMRERMAQLNPA
ASAKLANRLLEAHERNYWNPDEETLEALRRAGDELEDYYEGVNEEEQAA
NT seq 3750 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagcccacttcagtcgctgacccgacgccggtgcgcgtcgccatcatcacgctg
gacagccacatggcaggcgccgtggagcgcgcgcggccggctctgcaacgcgatatcccc
ggcctggagctgagctaccacgccgcctcggactggaacaacaacccggcggcgctggag
cgtgcccgggagcggatcgcctcggcggacatcatcgtcgcgacgatgctgttcatggag
gagcacatcgagcccgtgcgccaggatctggaggcgcgtcgggaggactgcgatgcgctg
gtcggcatcatgtcggctggcgaggtgatgaagctcacgcggatgggcaagttcaccatg
gacggcagcacgcgcggtccgatgtccctgctcaaaaagctgcgcgggaagaagggcaag
gcggagcagcaggacgatgacgacagcacctcgggggagaagcaggctgcaatgctgcgc
cgcatcccccgaatcctgcgtttcatccccggcacggctcaggatgtgcgggcctacttc
ctgacctggcagtacttcctggccagttccgacgagaacgtcgagaacatggtccggttc
ctcgtgaaccgttacgcagcagggccgcgcagcggcctgcgcggctctttggaggtgcag
gaccccatcgagtaccccgatgtcggcgtctatcacccccgcatggagcggcgcatcggc
gatgaccccaacgatcttccggaaccggagggtggtgcctcgcgcgggacggtgggcctt
ctgctgatgcgctcctatgtgctcgccggcgactcggcgcactacgacggcgtcatcgag
gccctggaaagccgggggtatcgtgtcgtcccggcattcgccagcggtctcgacaaccgt
ccggccgtcgagcggttcttcatggcggacggtcgtgcctgcgtcgatgcggtgatctcg
ctgaccagcttctcgctggtgggggggccggcctacaacaattccggggccgccgagcgg
ctgctgagaaggctcgatgtgccctacctgaatgcccaggccctggagttccagtccctg
gagcagtgggaggggtccgatcgtgggctcaccccggtggagacgaccatgatggtcgcc
atccccgaactcgatggtgcgaccgggccggtggtcttcggcggccgtgccgcggtgcct
ggccccgacggggtgtgccggatggaggtgcacccggagcgggcgaagatgctggcctcg
cgggtcgatcggctgatccgtctgcggcgcagcgcgcgcagcgagcgcaagctgagcatc
gtgatcttcagcttcccgcccgaggccggcgcgctggggtctgcggcctatctctcggtg
ttcgcctcgctctataacaccctggtggaactggacgacgccggctatcgggtggaattg
cctgagtccgtcgatgacctgcgtgatcgcatcatcaagggcaatgcggccaactacggt
gcgcacgccaacgtgcaccaccgagtgacggtcgacgactacgtggcccgcgagccctac
ctcaaggagatcgaggagcagtgggggccggcgccgggcaaggcgcagagcgacgggcag
tccatccatgtcctcggcgcgcagttcggcaacgtcttcatcggcgtgcagccgggcttc
ggctacgagggcgacccgatgcggctgctctttgagaaggggctgacgccgacccatgcc
atgtgcgccttctaccggtacatccgcgaggatttcggggcggatgccgtgctccacttc
ggtacgcacggcgccctggagttcatgccgggcaagcagtgcggcatgagcgccggctgc
tggccggatcgactgatcggcgacctgcccaactactatctgtacgcggccaacaacccc
tctgaggggtcgatcgccaagcgtcgctcggccgccacgctgatcagctacctgacgccg
ccggttggcaaggccggcctctacaagggcctgctggagctcaaggcttccgtggagcgc
taccgctcggccccgccggataacgtggaggagcgcaccgagctggcccgcctgatccag
gcccaggccgccgaggtcgacctcgctgagctggagccagaatggggcgaagaagaggct
gaacagcggatcgctcagctcagcgaagacatcctggagatggagtacaccctcatcccc
gaggggctccatgtggttgggcagcccccgtcccgcgagggccggatcgaccagctggtg
accatggccgagacgacccacggagtggcggtggaccgggcctgcgtcgaggcgctggtg
gacggacactcgcctcgcgaggccctggcccagtccgagagcgtcgaccccgagatgacc
gaggaggccctcgaagggttggctgataccgcgcagaagctggcggagaaccaggagctg
cagggcatcatccatgccctcgacgcccgtttcgtgcctccggtctcgggcggcgacctg
ctgcggagtccgcagattctgccgacgggccggaacatgcacgggttcgacccctaccgt
ctgcccagtgcctttgccgttcaggacggcgcgcggcaggctgagcgcctgctcgacaag
caccgcgaagaggggcaggaactgcccgactcgatcgcgatggtcctgtggggcacggac
aacctgaagagcgagggggcgccgatcggtcaggccctctacctcatcggtgcccggcca
cgcttcgacagcttcggcaagctggccggggcggaactcatccccttggacgagctcggt
cgcaagcgcatcgacgtggtgatcacgctctccgggatcttccgcgatctactgccgctg
cagacccgggtgctggctgaggcggcctacttgtccgcgtgcgccgaggatgagccgctg
gagatgaacccgatccgtcgcaacgccctggcgtatcaggagaagcatggctgcgacttc
gagaccgcggcgctgcgggttttctctaacgccgatggtgcctacggctccaacgttggc
tcgatgatcgaccaaggggcctgggaggacgaggacgagttggccgatacctatacccgg
cgcaagtgctacgcctacgggcgcagtggtgaaccggtgcgtcaggaggagctgctcggc
agcatgctctccggcgtcgagttgacctatcaaaacctggagtcggtcgagcttggcgtc
accaccgtcgaccactacttcgacacgctcggcggcatcagccgggccgtggcccgctcc
cggggcggcgagcacgtgccggtgtatatcggcgaccagacccggggcgagggcaaggtg
cggaccctctcggaccaggtggcgcttgagacgcggacccggatgctcaatccgaagtgg
tacgaagggctgctggagcacggctacgagggggtgcaccagatcgaggtgcacctgacc
aacaccatggggtggtccgcaaccaccggccaggtccagccgtgggtctatcagcagttc
acgcagaccttcatgctcgacgacgaaatgcgcgagcgcatggcgcaactcaacccggcg
gcgtcggcgaagctggccaaccggctgcttgaggctcacgagcgcaactactggaatccc
gatgaggagacgctcgaggcgctgcggcgtgccggggacgagctcgaggattactacgag
ggtgtcaacgaggaggagcaggccgcatga

DBGET integrated database retrieval system