KEGG   Halorhodospira halophila: Hhal_1744Help
Entry
Hhal_1744         CDS       T00462                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
hha  Halorhodospira halophila
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:hha00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1915075..1915725)
Genome map
AA seq 216 aa AA seqDB search
MVEAKLRDAEHAALLVVDVQPDFMPGGALPTQGGDEVVPPIARLLERAPSRYVVATQDWH
PPGHISFASSHPGCSPFEVIELHGVDQVLWPDHCVQETRGAALHDGVPWRHADLILRKAT
DPLVDSYSAFRENFAPDGRRPSTGLTGYLRELGVEQLYVCGLARDYCALWSAEDGAQAGF
GVHFLWDLTRPVDASNDASVQRTLQAAGVEIVTGVP
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtggttgaagccaagctaagagacgcggagcacgccgcgttgctcgtcgtcgacgtccag
ccggactttatgcccggcggtgcgttgccgacccagggcggcgacgaagtggtccccccc
attgcccgcctgctggagcgggcgcccagccgctacgtggtggcgacccaggactggcac
ccaccggggcacatctcctttgcctccagccatccagggtgttcccccttcgaggtgatc
gagctccacggcgtcgaccaggtgctctggcccgatcactgtgtccaggagacccgcggt
gcagccctgcacgacggggtcccatggcgccatgcagacctcatcctgcgtaaggccacc
gatccgctggtcgactcgtacagcgcgttccgcgagaacttcgccccggatggacggcgg
ccgtcgacgggtctgaccggctacctgcgcgaactcggtgtcgagcagctctacgtctgc
ggcctggcgagggactactgcgcactgtggagcgcggaggacggggcccaggcgggcttc
ggggtgcacttcctgtgggatctgacccgtcctgtggatgccagcaacgacgcctcggtg
cagcggacgctgcaggcggccggggtggagatcgtcaccggggtgccctga

DBGET integrated database retrieval system