KEGG   Halorhodospira halophila: Hhal_1767Help
Entry
Hhal_1767         CDS       T00462                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hha  Halorhodospira halophila
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hhal_1767 (tpiA)
   01230 Biosynthesis of amino acids
    Hhal_1767 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hhal_1767 (tpiA)
   00051 Fructose and mannose metabolism
    Hhal_1767 (tpiA)
   00562 Inositol phosphate metabolism
    Hhal_1767 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Hhal_1767 (tpiA)
Enzymes [BR:hha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hhal_1767 (tpiA)
Exosome [BR:hha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hhal_1767 (tpiA)
  Exosomal proteins of bladder cancer cells
   Hhal_1767 (tpiA)
  Exosomal proteins of melanoma cells
   Hhal_1767 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1940184..1940933)
Genome map
AA seq 249 aa AA seqDB search
MRRKIIAGNWKMNGDQDLVRRVAERAADSAGDAELAVCPPYPLLAAAASQLPFGVALGAQ
DVSEYDSGAYTGEVSASMLLEAGCRYVIVGHSERRTLYGEDNGRVAGKFVAARNAGLTPI
LCVGETLAERDAERTESVVGEQLDAVMDAVGGATFQGAVIAYEPVWAIGTGRTATPEQAQ
AVHAFIRQRVQERDAGEIADQLPILYGGSMKADNAAELLAQPDIDGGLIGGASLDPDSFL
SIYNAAAEG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcaagatcatagctggaaactggaagatgaacggcgaccaggatctggtccgc
cgcgtggcggagcgtgctgccgacagtgcgggggatgccgagttggccgtctgtccgccg
tacccgctgctggccgcggcggcttcacagctgcccttcggtgtcgcactgggcgcccag
gacgtgagtgagtacgactcgggcgcctacaccggtgaggtgtcggcgagcatgttgctc
gaagccggatgccgctacgtgatcgtcggccactccgagcgccggacgctctatggcgag
gacaatggccgggtggccggcaagttcgtggcggcgcgcaatgccgggctgaccccgatc
ctgtgcgttggtgagaccctggccgagcgcgacgctgagcgcaccgagtccgtggtcggt
gaacagctcgacgctgtgatggacgccgtcggcggcgccacctttcagggcgcggtgatc
gcctacgagcccgtgtgggccattggtaccggacgtaccgccacgccggaacaggcgcag
gcggttcatgcctttattcggcagcgcgtccaggagcgcgacgccggcgagatcgccgat
caactgcccatcctctacgggggcagcatgaaagccgacaacgctgccgagctgctggcc
cagccggatatcgacgggggtctgatcggtggcgcatcgctggatcccgacagtttcctt
tcgatttacaacgcagccgcggagggctga

DBGET integrated database retrieval system