KEGG   Halorhodospira halophila: Hhal_1804Help
Entry
Hhal_1804         CDS       T00462                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hha  Halorhodospira halophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hhal_1804
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hhal_1804
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hhal_1804
Enzymes [BR:hha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hhal_1804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1975979..1977193)
Genome map
AA seq 404 aa AA seqDB search
MRPEQDGGGPAEEHDGHFGRFGGRFVSETLVGPLEELTEAYAEARRDPGFQAELDRELRD
FVGRPTPLYLAERLTARAGGARIYFKREDLAHTGAHKVNNTVGQAVLAARMGKTRIIAET
GAGQHGVATATVAARMGLECVVYMGADDVQRQAANVYRMRLLGAEVRAVDAGTRTLKDAM
NEAMRDWVANIDNTFYIIGTVAGPHPYPTLVRDLQRVIGVETRAQILEREGRLPDAVVAC
VGGGSNALGIFHPFLDDADIRLVGVEAGGEGLASGRHAAPLNAGRPGVLHGARSYLMESD
EGQIIGTHSISAGLDYPGVGPEHAWLKDSGRAEYVTVTDAEALAAFHRLSRTEGILPALE
TSHAVAHAERLAAELGPDAALVVNLSGRGDKDIATVAAQEGIEL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagacctgagcaggacggcggcggccccgccgaggagcatgatgggcacttcggccgg
ttcggggggcggttcgtctccgagaccctggtcgggccgctcgaggagttgaccgaggcg
tacgccgaggcgcgccgcgacccgggtttccaggccgagctcgatcgcgagttgcgggat
ttcgtcggtcggcccactccgctgtacctggccgagcggctgaccgcccgcgccggcggt
gcacgcatctacttcaagcgcgaggatctggcccataccggcgcgcacaaggtcaacaat
accgtggggcaggcggtgctggccgcgcgcatgggcaagacgcggatcatcgccgagacc
ggggcggggcagcacggcgtggctacggcaaccgtcgcggcacgcatggggctggagtgc
gtcgtttacatgggggccgacgacgtgcagcgccaggccgccaacgtctaccggatgcgt
ctgctcggcgctgaggtccgcgccgtggacgccgggacgcgcaccctcaaggacgccatg
aacgaggcgatgcgcgactgggtggcgaatatcgacaacaccttctacatcatcggcacc
gtcgccggtccccatccctacccgacgctggttcgcgacctgcagcgggtcatcggtgtc
gagacccgagcgcagatcctggagcgcgaggggcgcttgcccgacgccgtggtcgcctgc
gtcggcggcggttccaacgccctggggatcttccatccgttcctggatgacgccgatatc
cggctcgtcggggtcgaggccgggggcgagggcctggcctccggccggcacgccgccccg
ctcaacgccggccgccccggtgtgctccacggtgcgcgcagttacctgatggagtccgac
gaggggcagatcatcggtacgcattcgatctccgccgggctcgattaccccggcgtcggc
cctgagcacgcgtggctgaaggattccgggcgcgccgagtatgtgacggtcaccgacgcc
gaggccctggccgctttccaccggctcagccgcaccgaaggcatcctgccggcgctggag
acctcccacgccgtcgcccacgcggaacgcctggccgcggaactcggcccggacgctgcg
ctggtggtcaatctctccgggcggggcgataaggacatcgccacggtcgcggcgcaggag
ggcatcgagctgtga

DBGET integrated database retrieval system