KEGG   Halorhodospira halophila: Hhal_1944Help
Entry
Hhal_1944         CDS       T00462                                 

Definition
protein-disulfide isomerase-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hha  Halorhodospira halophila
Brite
Enzymes [BR:hha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Hhal_1944
Secretion system [BR:hha02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Hhal_1944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2141623..2142186)
Genome map
AA seq 187 aa AA seqDB search
MRRESTSARAPRIRTARRAARVLVFGGCMGAATASVGMMPEEIAETLEAMPEEDLIVYEP
EEGEAEHSVTVFTDVTCPHCQDLHAELDAYLEQGIRVRYAAFALSDASRALMDQVWCSDD
RHEALEAAKSGEEPEAGACDASPVEDHQEVAQQIGVPGTPTMATPGGELSFRLTPEDLAD
LLEQEAH
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagggagtcgacgagcgcccgcgcgccgcgcattcggacggcacgccgtgccgcc
cgggtgctggtgttcgggggatgcatgggcgcggccaccgcgtcggtgggcatgatgccg
gaagagatcgccgagacccttgaggcgatgcccgaggaggatctgatcgtctacgaaccc
gaggagggggaagcggagcacagcgtgacggtcttcaccgatgtgacctgtccccactgc
caggatctccacgccgagctcgacgcgtacctggaacaggggatccgggtgcggtatgcc
gccttcgccctgtccgatgcctcccgggcgttgatggaccaggtctggtgcagcgacgac
cggcacgaggccctggaggcggcgaagtccggtgaagagcccgaggccggggcgtgcgac
gcgtcaccggtcgaggaccaccaggaggtggcgcagcagatcggggtgccgggtacgccg
accatggccacccccgggggcgagctctccttccggctgacgccggaggatctggccgat
ctgctggagcaggaggcgcactag

DBGET integrated database retrieval system