KEGG   Halorhodospira halophila: Hhal_2000Help
Entry
Hhal_2000         CDS       T00462                                 

Definition
phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase (EC:2.1.2.3)
Orthology
K00602  
phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
hha  Halorhodospira halophila
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hha00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:hha00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2204773..2206356)
Genome map
AA seq 527 aa AA seqDB search
MATNDGVRPLRRALISVSDKSGVEGFARALHEQGVEILSTGGTARLLGEAGIPVREVSAE
TGFPEIMDGRVKTLHPRIHGGLLGRRGTDDAVMDEHGIGPIDLLCVNLYPFEQAVAAEGC
TLTDAIENIDVGGPAMIRAAAKNHADVAVVTESSAYGLVLDELQRLGGTSRALRHHLATR
AFSHTARYDGAIAAYLSQRDEQGEQQGDFPAIWTLQVEKVADMRYGENPHQSAAFYRDVA
PGEASVSTARQLQGKALSYNNVADTDAALECVKGFQTPACVIVKHANPCGVACSGTLREA
YDRAFEVDPTSAFGGIIAFNDTVDAELAGAILDRQFVEVVIAPEVSDEALSRFAAKANVR
VLQTGRWPQHPGADLELKRVRGGLLVQDRDTAVVDPADLRVVTKRQPTDAEWADLRFAWE
VVRHVKSNAIVFAGGQRTLGVGAGQMSRVFSTRIACEKAADAGLALQGSVLASDAFFPFR
DGVDQAAEAGAAAVIQPGGSMRDQEVIDAADEHGLAMVFTGMRHFRH
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaacgacggcgtgcggcccctgcggcgggccctgatcagcgtttccgataag
agcggggtggagggctttgcccgcgccctgcatgagcaaggcgtcgagatcctctcgacc
ggtggtacggcccgcctgctgggtgaggccgggatcccggtgcgggaggtctcggccgag
accggcttcccggagatcatggacggtcgcgtcaagaccctgcatccgcgcatccacggc
gggctgctgggccggcgcggcacggatgacgcggtcatggacgagcacggcattggtccc
atcgatctgctttgcgtcaacctctaccccttcgagcaggccgtggccgccgagggctgc
accttgaccgacgccatcgagaatatcgatgtcggcgggccggcgatgatccgtgcggcc
gccaagaaccacgccgacgtggcggtggtgaccgagtcgtcggcctatggcctggtcctc
gatgagctccagcgccttggcgggaccagccgcgccctgcgccaccatctggcgacccga
gcgttcagccacaccgcgcgctacgacggcgccatcgctgcctacctgagccagcgcgac
gaacagggcgagcagcagggcgatttcccggcgatctggacgctccaggtggagaaggtc
gccgacatgcgttacggcgagaacccccatcaatccgctgccttctatcgcgatgtcgct
cccggcgaggccagcgtgtccaccgcccgccagctccagggtaaggccctgtcgtacaac
aacgtggccgacaccgacgccgccctggagtgcgtcaagggcttccagacgccggcctgc
gtcatcgtcaagcacgccaatccctgcggcgtggcctgctcggggacgttgcgggaggcc
tacgaccgggccttcgaggtcgatccgacctccgccttcggcggcatcatcgccttcaac
gataccgtcgacgccgagctggccggcgccatcctcgatcgccagttcgtcgaggtggtc
atcgccccggaggtcagtgacgaagccctgtcgcgcttcgccgccaaggccaacgtgcga
gtcctgcagaccggccgctggccgcagcatccgggcgcggatctggagctcaagcgggtg
cgtggcggcctcctggtgcaggaccgggacaccgcggtggttgatccggccgacctgcgg
gtggtcaccaagcgccagcccaccgatgccgagtgggccgacctgcgcttcgcctgggag
gtggtgcggcacgtgaagtccaacgccatcgttttcgccggcgggcagcgcaccctcggc
gtgggggccgggcagatgagccgtgtcttcagtacccgtattgcctgcgagaaggcggcc
gatgcgggcctggcgctgcagggctcggtcctggcctctgacgccttcttcccgttccgc
gacggcgtcgatcaggctgccgaggccggcgccgccgccgtgatccagcccggtggctcg
atgcgggatcaggaggtcatcgatgccgccgacgagcacggtctggccatggtcttcacc
gggatgcgccacttccgccactga

DBGET integrated database retrieval system