KEGG   Halorhodospira halophila: Hhal_2195Help
Entry
Hhal_2195         CDS       T00462                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hha  Halorhodospira halophila
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Hhal_2195
   00052 Galactose metabolism
    Hhal_2195
   00500 Starch and sucrose metabolism
    Hhal_2195
   00520 Amino sugar and nucleotide sugar metabolism
    Hhal_2195
Enzymes [BR:hha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Hhal_2195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2406803..2407696)
Genome map
AA seq 297 aa AA seqDB search
MSANYPIRTVVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAVAAGAEYLVFVT
GRTKRAIEDHFDTATELERELEAKGKEKLLRLVKDTVPKGVSCIYIRQGEALGLGHAVAC
ARPAVGRREPFGVILADDLINAGDGAPALAQMAEVAAARGGSVLGVERVPQAETDKYGVV
EGETVADGVTAVRGMVEKPSPAEAPSNLAVVGRYILSRNIFDHLDRTEPDHRGEIQLTDA
IVSLMAEESVYAYEYAGERYDCGSKLGYLQATVAYGLEHPELGPAFRDYLKGLDTGA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgccaactaccccatccgaaccgtcgtcttcccggtggccgggctcggcactcgc
ttcctgccggccaccaaggccagtcccaaggagatgctgccggtcgtcgacaagccgctg
atccagtacgccgtggaagaggccgtggccgccggcgccgagtacctggtcttcgtcacc
ggtcgcaccaagcgcgccatcgaggaccacttcgataccgccaccgaactggagcgggaa
ctcgaggccaagggcaaggagaagctcctccggttggtcaaggacaccgtgcccaagggg
gtcagctgtatctacatccgccagggcgaggccctggggctggggcacgccgtcgcctgt
gcccgtccggcggtcggccgccgtgaaccgttcggcgtcattctcgccgacgacctgatc
aacgccggtgacggtgccccggcgctggcccagatggccgaggtggccgccgcccgcggt
ggttcggtgctcggtgtcgagcgcgttccgcaggccgagacggacaagtacggcgtcgtc
gagggcgagaccgtggccgacggggtgaccgccgtgcgcggcatggtcgagaagcccagc
cccgctgaggccccgtcgaatctggcggtggtcggacgctacatcctgtcacgcaacatc
ttcgaccacctcgaccggaccgagcccgaccaccggggggagatccagctcaccgatgcc
atcgtctccctgatggcggaagagtcggtgtacgcttacgagtacgccggcgaacgctac
gactgcggcagtaagctcggctacctgcaggccacggtggcctacggactcgaacatccg
gaactcggcccggccttccgggactatctcaaagggctggacaccggcgcctga

DBGET integrated database retrieval system