KEGG   Halorhodospira halophila: Hhal_2247Help
Entry
Hhal_2247         CDS       T00462                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
hha  Halorhodospira halophila
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hhal_2247
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hhal_2247
   00630 Glyoxylate and dicarboxylate metabolism
    Hhal_2247
Enzymes [BR:hha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Hhal_2247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2466855..2469038)
Genome map
AA seq 727 aa AA seqDB search
MSERVQVGGLQVARELHDLVANEIVPGTGIDADTVWDELGGIVRDLAPRNRELLEQRENL
QRQIDDWHRNHRGQFSVSDHKAFLEQIGYLEPEVDAFEITTTGVDPEIATVAGPQLVVPV
DNARFALNAANARWGSLFDALYGTDMIPESDGLAKGKTYNPARGKKVMELAAETLDEVAP
LAHGLHAEVTAYRLSDGNPRQLVITLADGSETELADPTRFVGFTGEPDRPATLLLRHNGL
HAEIVIDPNDPIGQDHPAGVKDVVMESALTAIQDCEDSVAAVDAEDKVRVYRNWLGLMKG
DLETSVSKGGETFTRRLNPDRTYTAPDGGSLTLPGRSLMLVRNVGHLMTTPAVLDGDGNE
IPEGMLDAMMTVLCAVHDLKGLGQVCNSKTGSVYIVKPKMHGPEEVALTVNLFERVEDAL
GLARATLKVGIMDEERRTTVNLRACIQQARDRVIFINTGFLDRTGDEIHTAMEAGAVIRK
ADMKGAAFMTTYEDWNVDVGLASGFKGKAQIGKGMWPKPDKMREMFDTKAGHPKAGANCA
WVPSPTAATLHAVHYHQVDVAGVQAEIAREGWRSDLSRILTVPLAPSTDWSAEEIQQEVD
NNCQGILGYVVRWIDQGIGCSKVPDVNNVGLMEDRATLRISSQHVANWLYHGVVTEEQVM
DSLKRMAQVVDEQNAGDPNYRPMAEDFDGSVAFQAACDLVFKGREQPSGYTEPVLHRRRQ
EAKAKYA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacgggttcaagtcggtggcctgcaggtggcgcgtgaactccacgacctggtg
gccaacgagatcgtgccggggaccggcatcgacgccgacaccgtgtgggacgagctcggc
ggcatcgtccgcgatctggctccgcgcaaccgcgagttgctggaacagcgcgagaacttg
cagcggcagatcgacgactggcatcggaaccatcgtggccagttctcggtatccgatcac
aaggcgttccttgagcagatcggctacctggaacccgaagtggacgcgttcgagatcacc
accaccggggtcgacccggagatcgccaccgtggccgggccgcagctggtggtgccggtc
gataacgcgcgattcgcgctcaacgcggccaacgcgcgctggggcagcctgttcgatgcc
ctctacggcaccgacatgatccccgagagcgacgggctagccaagggcaagacgtacaat
cccgctcgcggtaaaaaggtcatggagttggccgccgagaccctggacgaggtggccccg
ctggcccatgggctccacgccgaggttaccgcctaccggctgagcgacggcaacccgcgc
cagctggtcatcaccctggccgacggcagtgagaccgaactggccgatccgacccgcttc
gtcggcttcaccggcgagccggatcgccccgccaccctcctgctgcgccacaacggcctc
cacgccgagatcgtcatcgacccgaacgacccgatcggtcaggatcacccggccggcgtc
aaggacgtggtcatggagtcggcgctgaccgccatccaggactgcgaggactccgtggcc
gcggtggacgccgaggacaaggtgcgcgtctaccgcaactggttgggcctgatgaaaggc
gacctagagacgtcggtgagcaagggcggcgagacctttacgcggcggctcaacccggat
cgcacctacacggccccggacggcggctcgctgaccctgccgggccgctcgctcatgctg
gtgcgcaatgtcggtcacctgatgaccacaccggcggtcctcgacggcgacggcaacgag
atccccgagggcatgctcgacgccatgatgaccgtcctctgcgcggtccacgacctcaag
gggctcggacaggtatgcaactcgaagaccggcagcgtctacatcgtcaagccgaagatg
cacggtcccgaggaggtggcgctgaccgtgaacctgttcgagcgcgtcgaggacgccctg
ggtctggcgcgtgccaccctcaaggtgggcatcatggatgaggagcggcgcactacggtc
aacctgcgtgcctgcatccagcaggcccgggatcgggtgatcttcatcaacaccggcttc
ctcgaccgcactggcgacgagatccacaccgccatggaggccggcgcggtgatccgcaag
gcggacatgaagggggccgccttcatgaccacctacgaggactggaacgtcgatgtcggc
ctggcttccggcttcaagggcaaggcccagatcggcaagggcatgtggccgaagccggac
aagatgcgcgagatgttcgacaccaaggctggccaccccaaggcaggcgcgaactgtgcc
tgggtgccgtcgccgacggcggcgaccctgcacgctgtgcactaccaccaggtggacgtg
gctggcgtccaggccgagatcgcccgggaggggtggcgttccgacctgagccggatcctc
accgtgccgctggcgccgagcaccgactggagcgccgaggagatccagcaggaggtggac
aacaactgccagggcatcctcggctatgtggtgcgctggatcgaccagggcattggctgc
tccaaggtcccggacgtcaataacgtggggctgatggaggatcgcgccacgctgcgcatc
tccagccagcacgtggccaactggctctaccacggcgtggtgaccgaggagcaggtcatg
gacagcctcaagcgcatggcccaggtggtcgacgagcagaacgccggcgacccgaactac
cgccccatggccgaagacttcgacggcagcgtcgccttccaggcggcctgtgatctggtc
ttcaaggggcgggagcagccctccggttacaccgagccggtgctccatcgccgtcggcag
gaggcgaaggcgaagtacgcctga

DBGET integrated database retrieval system