KEGG   Halorhodospira halophila: Hhal_2297Help
Entry
Hhal_2297         CDS       T00462                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hha  Halorhodospira halophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hhal_2297
   00030 Pentose phosphate pathway
    Hhal_2297
   00051 Fructose and mannose metabolism
    Hhal_2297
   00052 Galactose metabolism
    Hhal_2297
   00500 Starch and sucrose metabolism
    Hhal_2297
   00520 Amino sugar and nucleotide sugar metabolism
    Hhal_2297
  Nucleotide metabolism
   00230 Purine metabolism
    Hhal_2297
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hhal_2297
Enzymes [BR:hha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Hhal_2297
    5.4.2.8  phosphomannomutase
     Hhal_2297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2524966..2526360)
Genome map
AA seq 464 aa AA seqDB search
MSAAQVPASIFRAYDVRGVVGETLNADIVRWVGRAVGSEARERGVRRLVVGRDGRHSSAE
LAAAVAAGMNDAGCDVVDIGQAPTPVMYFATHELETGSGVMITGSHNPPEYNGLKIMVAG
DTLSGEAITALYRRIQDGCLSAGEGGVESRTDLVERYLARITGDIRPARSLRVVLDAGNG
VAGAVAPQLFEALGCEVEALFCDVDGDFPNHHPDPAEPHNLETLIARVRESGADLGLAFD
GDGDRLGVVDSAGKIIWPDRQLMLYARDVLSRRPGEPVVFDVKCSMHLKQVIEAAGGRPQ
MSRTGHSLIKATLRETGAPLAGEMSGHTFFAERWYGFDDGLYTGARLVEIVAADGRPSAE
IFAELPEGVSTPELKVHIQEGEQVELMDALVTEGQRRFTDATIHTIDGIRVEWSDGWGLI
RASNTTPVLVVRFEANDDAGLARIREAFEALLAAVRPGLAIPGG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcagcgcaagtacccgcatcgatctttcgtgcctacgacgtccgtggcgtggtg
ggcgagaccctgaatgccgacatcgtccgctgggtgggccgtgcggtgggcagcgaggcg
cgcgagcgcggcgtccgccgcctggtggtcggccgtgacggccgtcactccagtgccgag
ctggccgcggcggtggctgccggcatgaacgacgccggatgcgatgtcgttgacatcggc
caggcccccacgccggtgatgtacttcgccacccacgagctggagaccggctccggggtg
atgatcactggcagccacaacccgccggagtacaacggactgaagatcatggtcgccggc
gacaccctctctggcgaggccatcacggccctctatcggcgcatccaggacggctgcctg
tccgcaggggaggggggcgtggaatcgcgtacggacctggtggagcgctacttggcgcgg
attaccggcgatatccgcccggcgcgttccctgcgggtggtcctcgatgccggtaacggc
gtcgccggcgcggtggcgccgcagctcttcgaggccctgggctgtgaggtggaggccctg
ttctgcgacgtggatggcgacttccccaaccaccatccggacccggccgaaccgcacaac
ctggagacgctcatcgcacgggtccgcgagagcggggccgacctgggcctggcctttgac
ggcgacggcgatcgcctcggggtcgtggactcggcaggcaaaatcatctggcccgaccgg
cagctgatgctctacgcccgcgatgtgctcagccgccgtcccggcgagccggtggtcttc
gacgtcaagtgcagtatgcacctcaagcaggtcatcgaggcggccggtgggcggccgcag
atgtcgcgcaccgggcactcgctgatcaaagccacactgcgcgaaaccggtgccccgctg
gccggcgagatgagcggccacaccttcttcgccgagcgctggtacggcttcgacgacggt
ctttacaccggcgcgcggctggtggagatcgtcgccgccgacggccggcccagcgccgag
atcttcgccgaactgcccgagggtgtctccacgccggagcttaaggtgcacatccaggag
ggtgaacaggtcgagctcatggacgcactggtgacggaagggcagcggcggttcaccgac
gccaccatccacaccatcgacggcatccgtgtggagtggtctgatggctgggggttgatc
cgcgcctccaacaccacgccggtgctggtggtgcgtttcgaggccaacgacgacgccggc
ctggcccgcattcgggaggccttcgaggctctgctcgcggccgtgcggccggggctggcg
atacccggcggatga

  All links  
No link information was found.   
DBGET integrated database retrieval system