KEGG   Halorhodospira halophila: Hhal_2315Help
Entry
Hhal_2315         CDS       T00462                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hha  Halorhodospira halophila
Brite
Enzymes [BR:hha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Hhal_2315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2540245..2540910
Genome map
AA seq 221 aa AA seqDB search
MTQSVTDSARDNMIRRQIRPWNVLEPRVLEALEAIPREDFVPEHLRGMAYSDLQLPLGNG
EVMMEPRLEGRMLQELDPAPGEKALEVGTGSGYVTACLAHLCGHVTSVELHADLHRQAQQ
RLEAAGVAEGTELVQGDAAHGWHDAQHYDVISVTGSLPELHDGFHSSLTIGGRLFVIVGQ
GPMMEALRITRTGPNAWSTQSVFDTAVPPLRGLTKRDPFKL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaagcgtgactgattcggcacgcgacaacatgatccgccgccagatccgcccg
tggaacgtgctcgagccgcgggtgctggaggcactggaggcgatcccccgcgaggatttc
gtacccgagcacctgcgcgggatggcgtacagcgacctgcaactgccgctgggcaacggc
gaggtgatgatggagccccgcctggaagggcggatgctgcaggaactggacccggcaccg
ggcgagaaggcgctggaggtcggcactggcagcggttacgtcaccgcctgcctggcccac
ctgtgtggccacgtaaccagtgtcgagctgcacgccgacctgcaccgacaggctcagcag
cggctcgaggccgccggggtagccgagggcaccgagctggtccagggcgatgccgcccac
ggctggcatgatgcccagcactacgacgtgatctcggtcaccggctccctgcccgagctc
cacgacggcttccacagctccctgaccatcggcggccggttgttcgtcatcgtcggtcag
ggcccgatgatggaggccctgcgcatcacccgcacgggccccaacgcctggtcgacccag
agcgtcttcgataccgcagtgccgccgctgcgcggcctgaccaagagggatccattcaag
ctttga

DBGET integrated database retrieval system