KEGG   Halorhodospira halochloris: M911_03670Help
Entry
M911_03670        CDS       T03059                                 

Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hhc  Halorhodospira halochloris
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hhc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M911_03670
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M911_03670
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    M911_03670
   00680 Methane metabolism
    M911_03670
Enzymes [BR:hhc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     M911_03670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(740075..742921)
Genome map
AA seq 948 aa AA seqDB search
MTQHPDRVQDSSTGDKPLRARVKLFGKLLGNIIRRLEGPEVFRAVETLRRGFVSLRQQDD
PDKRARLMRLIDEMDPKRLETIIRAFSIYFSLANLAEEDFLYRERRRQVTRGGPLWLGSF
DHTVREFQASDVSAEQLQFLLEQVKYMPVFTAHPTEARRRTVMEAQRRIFLAAEPLNKGR
IGREERREVIRQLETQIQVLWRTNEVRVTKPEVLDEIKYGLFYYEESLFTAVPLTYRLLE
KAIRRTYGTDEAGRPNVRIPSLLRFGSWIGGDRDGNPYVTPAVTERACRLAMEQVLSEYL
RRVHDLRFVLTHSSLMCQPTQALMDSLAEDDSISSAVFREGLNEMRTEPYRRKLYFIRHR
LSETLNTVRRRLAGETAVLPVQSAYHGPEELLGDLYVIRDSLESHGDGNIAGADLTDLIR
LVETFGFHLHHLDIRQESLVHTAAVAEILASTGEEADYDAQDEPTRLTLLGRLLTRDDFT
CDIDVLSEETRQTLAVFQTMARLRGEVGGDGIGTYVISMTHAASHVMEVMLLARLADLAK
LGPGEELEADVCHVRISPLFETIEDLHHVESVLESLLGDPVYARLLKASGNRQEVMLGYS
DSCKDGGILASAWNLYDAQRKIIDITEAHGVECRLFHGRGGTIGRGGGPTHESIMAQPPG
TVQGEIKFTEQGEVLSYKYSNVETAVYELSIGATGLIKASRGLIGQGGQDNPDFLGVMNA
LAEHGEQAYRGLTDQTPGLLDYFYEATPVEEIGRMNIGSRPSHRRKADRSKSSIRAIPWV
FGWAQSRHTVPAWYGIGTALQTWHGEDPERLAQLQSMYREWPFFHSLLSNCQMSLSKADM
GIAQEYAELCQDQDQAQRIYQVIRDEYQRTVAQVLAVSGAGSLLEENPTLALSLTRRDPY
LDPLNHIQIILLRRYRALHAQGEKAEDPWISPLLRSINAIAAGMRNTG
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcaccccgatcgcgtacaggacagctccactggagacaagcccctgcgggcc
cgcgtgaaactcttcggcaagctgctgggcaacatcatccggcgcctggaggggccggag
gtctttcgtgccgtggagaccctgcgtcgcggcttcgtgtccctgcgccagcaggacgac
ccggacaagcgcgcccgtctgatgcggttgatcgacgagatggacccgaagcgcctggag
accatcattcgggccttcagtatctatttcagtctcgccaacctggcggaagaggacttc
ctctaccgggagcgtcggcgccaggtcacgcggggcggtcccctgtggctgggttccttt
gaccacacggtgcgggaattccaggcgagcgacgtgagtgccgagcagttgcagttcctg
ctggagcaggtgaagtacatgcccgtgttcaccgcccaccccacggaggcccggcgccgc
acggtcatggaagcgcagcgacgcatcttcctggccgccgagcccctcaacaagggtcgt
atcggccgggaggaacgacgcgaggtgattcgccaactggaaacccagattcaggtgctg
tggcgcaccaatgaggtgcgggttaccaagcccgaggtgctcgacgagatcaagtacggg
ctgttctactacgaagagagcctgttcaccgccgtgcccctcacctaccggctgctggaa
aaggccattcgccgcacctacggcacggacgaggcgggccgacccaacgtgcgtatcccg
agcctgctgcgtttcggctcctggatcggcggggaccgggacggcaatccctacgtgacc
cctgcggtcaccgagagggcctgccgcctggccatggagcaggtactgtcggagtatctg
cggcgggtgcacgacctgcgcttcgtgctcactcactcttccctgatgtgccagcccacc
caggcactgatggacagtctggccgaggatgacagcatctcctcggcggtcttccgggag
gggctcaatgagatgaggaccgagccctaccgccgcaagctgtatttcatccgtcaccgc
ctttccgaaaccctgaacacggtgcgtcgccgcctggcgggcgagaccgccgtgctgccg
gtccagtccgcctatcacggcccggaggaactgctaggggacctctacgtgatccgggac
tccctggaaagccatggggatggcaatatcgccggcgccgacctgaccgacctgatccgg
ctcgtggagaccttcgggtttcacctgcatcatctggatattcgccaggagtcgctggtg
cacacggctgccgtggccgagatccttgccagcacgggcgaggaggccgattacgacgct
caggatgagccgacgcgactcaccctgctgggacgtctgctgacccgggatgatttcacc
tgcgacatcgacgtgctgtcagaggagacacgccagaccctggcagtcttccagaccatg
gctcgtctgcgcggggaagtgggcggtgacggcatcggcacctatgtgatttccatgacc
catgccgcgtcccacgtcatggaggtgatgctgctggcccgactcgcggacctggcaaag
ctgggccccggggaggaacttgaggccgatgtctgccatgtacggatttcgcccctgttc
gagaccattgaggatctgcaccacgtggaatcggtgctggagtccctgctgggtgacccg
gtctatgcgcgtctgctcaaggcctccggcaatcgtcaggaggtgatgctgggctactcc
gattcctgcaaggacggcggcatcctggcctctgcctggaacctctacgatgctcagcgc
aagatcatcgacattaccgaggcccatggcgtggaatgccggctgttccatggccggggc
ggcaccatcggccgcggcggtggccccacccacgaatccatcatggcccagccgcccggc
accgtgcagggggagatcaagttcaccgagcagggggaggttctgtcctacaagtacagc
aacgtggaaaccgccgtctatgagctgagtatcggcgccaccggtctgatcaaggccagc
cggggcctgatcggccagggcggccaggacaaccccgacttcctgggcgtgatgaatgcc
ctggccgagcatggcgaacaggcctatcgggggctgacggatcaaacgccgggcctgctg
gactatttctacgaggccacgcccgtggaagaaatcggtcgcatgaacatcggctcacgt
ccctcccaccggcgcaaggcggatcgctccaagagttccatccgggccatcccctgggtg
ttcggctgggctcagtcccggcacaccgtccccgcctggtacggtatcggcacggccctg
cagacctggcatggggaggatcctgagcgactggctcaactgcaatccatgtaccgggaa
tggcctttcttccattcactgctgtccaactgccagatgtccctgtcgaaggcggacatg
ggcattgcccaggaatacgcggagttgtgccaggatcaggaccaggctcagcggatctat
caggtgatccgggatgagtaccagcgcacggtggctcaggtgctggcggtctcgggggcc
ggatcattgctggaggaaaatcccaccctggccctgtcactgacccgtcgtgacccctat
ctggatcccttgaaccacatccagatcatcctgctcaggcggtatcgtgccctgcacgcc
cagggcgagaaggccgaagacccctggatatcgccgctgttacgctccatcaacgccatt
gccgcgggcatgcgcaacacgggttga

DBGET integrated database retrieval system