KEGG   Halorhodospira halochloris: M911_13305Help
Entry
M911_13305        CDS       T03059                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
hhc  Halorhodospira halochloris
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hhc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M911_13305
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    M911_13305
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M911_13305
Enzymes [BR:hhc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     M911_13305
Exosome [BR:hhc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M911_13305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2753998..2755788)
Genome map
AA seq 596 aa AA seqDB search
MRFRSSTVAVVTTVALVWAMAPAQAAMPKNVIVLIPDGQSQSVVTLGRLYRGEPLALDEI
ATGMVNTSMTNSVITGSAAAGTAFATGYKTSEPHIGMAPRSYDILSNYQLPEGVDWDWFE
YRPLATLLEGAQLAGKATGVVATSRISHATPASYTAHVDARGKENEIMKHMVYQNLDVVF
GGGSRHLLPRSMGGSRDDGENLRQVLHDRGYQVIDHADDLHGIHSDRVWGLFASSSMMPE
LDRRYLRENGHDYDVSLHEQALAEPSLSEMTAKALDILSQDRDGFFLMVEGSQVDWAGHS
NDVIYHLQDFLEFDDTVGLALDFAKRDGQTMVVVMPDHNTGALALGNWASSGNYTRTSIE
RVIEPLQGMQVTANFLSAQLPRNPSDGDIRDTVAKYWNIHLSDDDLATIRDEQSIRGLQR
AIIKVVNDNHTIFGWTTHGHSGEDVPLWSYGPGAPTGYVDNADIGQIMGKAMRLNLSLTH
PSGLNQRLFVDVQEHFPEAVVDDTGATLGEWRLVNGTDVLQRGDDTCQLEGLVVHSPLAG
GGEGRTFVPAQAIEIMQRPVMWNRHCGVSQPTNLGQSIRDRVHERLERAFSERGMR
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttcgatcttcaaccgtggcggtggtcaccaccgtcgccctggtttgggccatg
gctccggctcaggccgcaatgcccaagaacgtgattgtgttgataccggatggtcagtcc
cagtcggtggtgaccttggggcggctctatcggggcgagcccctggcattggatgagatt
gccacgggcatggtgaataccagcatgaccaactcggtcatcaccggctcggcggcggcg
ggtaccgcgtttgccaccggttacaagacctccgagccacatatcggcatggcgccgcgt
agctacgatatcctgagcaactaccagttgcccgagggagtggactgggattggtttgaa
taccgtcccctggccacgctgctggaaggggcccaattggcgggcaaggccacgggggtg
gtggccacctcgcgtatcagtcatgccaccccggctagctacacggcccacgtggacgcc
cgcggcaaggagaacgagatcatgaagcacatggtctaccagaacctggatgtggtcttc
gggggcggtagccggcacctgttgcccaggagcatgggcggctcgcgggacgatggcgaa
aatctccggcaggtcttgcacgaccgcggttatcaggtcatcgaccatgccgatgacctg
catggcatccattccgatcgcgtctggggcctgtttgcttccagcagcatgatgccggaa
ctggaccgtcggtatctgcgggaaaacggccacgactatgacgtgagtctgcacgaacag
gccctggcggaaccctcgttgtcggagatgacggccaaggccctggatatcctgtcccag
gatcgggatggcttcttcctgatggtggaagggagccaggttgactgggcgggtcactcc
aatgacgtcatctatcatctccaggatttcctggaatttgacgatacggttggcctggct
ctggattttgccaagcgcgacggccagaccatggtggtggtcatgcctgaccacaacacc
ggtgcactcgccctgggtaactgggccagcagtggcaactacacccgtacctccatcgag
cgggtgatcgaacccctccaggggatgcaggtgacggccaacttcctcagtgcgcagctg
ccgagaaacccgtctgatggcgacatccgtgacacggtggccaagtactggaatatccac
ttgtcggatgacgacctggcgaccatccgcgatgagcagtccatccgcggtctgcagcgg
gccatcatcaaggtggtcaacgacaaccacaccattttcggctggaccacccacggtcac
tccggggaggatgtgcccctgtggagctacggccccggtgctcccaccggctatgtggat
aatgcggatatcggccagatcatgggcaaggcgatgcgtctgaatctttcgctgacccat
cccagcggtctgaatcagcgccttttcgtggatgttcaggagcacttccccgaggccgtc
gtggatgacacgggggccaccctgggtgagtggcgtcttgtgaacggtaccgatgtgctg
cagcgcggagatgacacctgccagttggaaggtctggtggtgcattccccgttggcaggt
ggtggcgagggccgcaccttcgtgcccgctcaggccatcgagatcatgcaacggccggtg
atgtggaatcgccattgtggcgtctcccagccaaccaacctggggcagagcatccgtgac
cgggtgcacgagcggctggagcgggccttcagcgaacgtggaatgcgctga

DBGET integrated database retrieval system