KEGG   Halorhodospira halochloris: M911_13575Help
Entry
M911_13575        CDS       T03059                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hhc  Halorhodospira halochloris
Pathway
hhc00071  Fatty acid degradation
hhc00072  Synthesis and degradation of ketone bodies
hhc00280  Valine, leucine and isoleucine degradation
hhc00310  Lysine degradation
hhc00362  Benzoate degradation
hhc00380  Tryptophan metabolism
hhc00620  Pyruvate metabolism
hhc00630  Glyoxylate and dicarboxylate metabolism
hhc00640  Propanoate metabolism
hhc00650  Butanoate metabolism
hhc00900  Terpenoid backbone biosynthesis
hhc01100  Metabolic pathways
hhc01110  Biosynthesis of secondary metabolites
hhc01120  Microbial metabolism in diverse environments
hhc01130  Biosynthesis of antibiotics
hhc01200  Carbon metabolism
hhc01212  Fatty acid metabolism
hhc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hhc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M911_13575
   00630 Glyoxylate and dicarboxylate metabolism
    M911_13575
   00640 Propanoate metabolism
    M911_13575
   00650 Butanoate metabolism
    M911_13575
  Lipid metabolism
   00071 Fatty acid degradation
    M911_13575
   00072 Synthesis and degradation of ketone bodies
    M911_13575
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M911_13575
   00310 Lysine degradation
    M911_13575
   00380 Tryptophan metabolism
    M911_13575
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M911_13575
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M911_13575
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M911_13575
Enzymes [BR:hhc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M911_13575
Exosome [BR:hhc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M911_13575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHK80010
UniProt: W8L844
Position
complement(2813241..2814428)
Genome map
AA seq 395 aa AA seqDB search
MADSTVIVGAARTPVGTFNGSLAKIPASTLGALVIKGLLERSGMSPEQVDELILGQVLQA
GVGQNAARQAAVEAGIPYTSPAMTINKVCGSGLKSVQLAWQAIRCGDAGVVIAGGQENMS
ASPHVLPNSRQGTKMGDWKMVDTMIRDGLWCAFNDYHMGTTAENVATEFKISREEQDAFA
AQSQQRAEAAQKAGHFKDEIIPVEVPGRKRGETVTFDTDEFPRHGTTAEGLGKLRPAFSR
DGTVTAGNASGINDGAAAVIVMSESKAREWGLTPLARIVSFSSAGVDPAIMGTGPIPAAT
QCLEKAGWKPADLDMVEANEAFAAQAIAVNKTMGWDLSKVNVSGGAIAIGHPIGASGARV
LVTLLHGMKRTGARKGLATLCIGGGQGVALAVESV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctgattccacggtcatcgtcggtgccgcccgcacccccgttggtacgtttaatggt
tccctggcgaagattcccgcttccactttgggggcgctggtcatcaaggggttgctggaa
cggtcgggcatgtcccctgagcaggtggatgagctcatcctggggcaggtgctgcaggcc
ggcgtgggccagaacgctgcccgtcaggcagcagtggaggcgggcatcccgtatacgtcc
ccggccatgaccatcaataaggtgtgcggtagcggcctgaagtcggtgcaactggcctgg
caggccattcgctgcggcgatgccggcgtcgtcatcgctggaggtcaggagaacatgagc
gcgtcgccgcacgtgctgccgaactcccgtcagggcaccaagatgggcgactggaagatg
gtggataccatgatccgcgatggcctgtggtgtgccttcaatgactatcacatgggcacc
accgccgagaacgtggccaccgagttcaagatcagccgcgaggagcaggacgcctttgcc
gctcagtcgcaacagcgggccgaggcggcccagaaggccggtcatttcaaggatgagatc
attcctgtggaggtgcccggtcgcaagcggggtgaaaccgtgactttcgataccgacgag
ttcccccggcatggcaccaccgccgaaggtctgggcaagctgcgccccgccttcagtcgc
gatggtaccgtgaccgccggcaatgcctccggcatcaacgacggcgccgccgccgtgatc
gtcatgtctgaatccaaggcccgtgaatgggggttgaccccgctggcacgcatcgtgtct
ttctcctcggcgggtgtggacccggccatcatgggcaccggccccatcccggcagccacc
cagtgcctggaaaaggccggctggaagcctgcagatctggacatggtggaagccaatgag
gcctttgcagctcaggccattgccgtcaacaagaccatggggtgggacctgtccaaggtg
aacgtcagtggtggcgccatcgccattggccaccccatcggtgcctccggtgctcgtgtg
ctggtcaccctgctgcatggcatgaagcgcaccggcgcccggaagggtctggcaaccctg
tgcattggcggtggtcagggcgtggcgctggcggtggagagcgtctga

DBGET integrated database retrieval system