KEGG   Halobacillus halophilus: HBHAL_1016Help
Entry
HBHAL_1016        CDS       T02031                                 

Definition
(GenBank) deoxynucleoside kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00230  Purine metabolism
hhd00240  Pyrimidine metabolism
hhd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HBHAL_1016
   00240 Pyrimidine metabolism
    HBHAL_1016
Enzymes [BR:hhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     HBHAL_1016
    2.7.1.76  2'-deoxyadenosine kinase
     HBHAL_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Thymidylate_kin SKI AAA_28 Cytidylate_kin2 RsgA_GTPase AAA_15 MMR_HSR1 TsaE AAA_33 AAA_29 ABC_tran RNA_helicase AAA_22 ATPase ATP_bind_1 AAA_16 AAA_25 ArgK ParA
Motif
Other DBs
NCBI-ProteinID: CCG43403
UniProt: I0JGY5
Position
complement(19354..20037)
Genome map
AA seq 227 aa AA seqDB search
MNARERYGIPHDSVITIAGTVGVGKSTMTNALADALKFRTSFEKVETNPYLDKFYHDFER
WSFHLQIYFLAERFKEQKKIFEYGGGFIQDRSIYEDTGIFARMHYEKGTMSEIDYQTYKN
LFDAMVMTPYFPHPDLLIYLEGSFDDVVDRIKERGRPMEQETPVEYWEEMFKRYENWIEN
FNSCPVLRLNIADYDVLNDENSIEPVMEKIGHFIQQSRKWRSSHLLT
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgtgaacgctatggaataccacatgacagcgtcattacaattgcaggcaca
gttggagtagggaaatctaccatgacgaatgcattagctgatgcccttaaatttcgtact
tcttttgaaaaagtagaaaccaatccttaccttgataagttttatcatgattttgaacgt
tggagcttccatttacaaatttactttttagctgaacgttttaaagagcagaagaaaatc
tttgaatatggcggtggatttattcaggatcgttcgatttatgaagatacaggcattttc
gcccgtatgcattatgaaaaaggaacgatgtctgaaatagattaccaaacgtacaagaat
ttattcgatgccatggtcatgactccctatttccctcatccggatttattaatttatctg
gaaggatcatttgatgacgttgtcgatcgaattaaagagcgaggacggccaatggaacag
gaaacgcctgtcgaatattgggaggaaatgttcaaacgttatgagaattggattgagaat
ttcaattcctgcccagttcttcggctgaatatagcggactatgatgtgttaaatgatgaa
aacagtattgaaccggttatggaaaagataggacattttatccaacaatcccgcaaatgg
cgttccagccacttgctcacctaa

DBGET integrated database retrieval system