KEGG   Halobacillus halophilus: HBHAL_1107Help
Entry
HBHAL_1107        CDS       T02031                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
hhd  Halobacillus halophilus
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:hhd00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
120384..121853
Genome map
AA seq 489 aa AA seqDB search
MSNEVRVRYAPSPTGHLHIGNARTALFNYLFARNAGGKMVIRIEDTDEKRNVEGGEQSQL
NYLRWLGIDWDESPDKGGEYGPYRQMERLDLYQKYVDDLLERGLAYKCYMTAEELEAERE
AQIARGEAPKYSGAHRDLSQEQIEQFEAEGREPSIRLRVPENHTYTFNDIVRENITFESS
DFGDWVIVKKSGTPTYNFAVAVDDYLMAITHVLRGEEHISNTPKQMMVYEAFGWEPPKFG
HMTLILNENRKKLSKRDEHILQFIEQYKNLGYLPESLFNFITLLGWSPVGEEEIFTQDKL
IEIFDAERLSTSPAVFDPAKLKWMNNQYIKSAEFDRVVELTLPHLIEAGRVSENMSDSDR
EWVHELIALYQEQLDYGAQIVELTELFFKQEIQYDESAMEVLEGEQVPEVLDTFKKKLNE
LEEFTPEAIKKQVKAVQKETGHKGKKLFMPIRVATTGQTHGPELPNAIHLLGLETVNVRL
DDVLNKLQG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgaagttcgagtacgttatgcacccagcccgaccggccatcttcacattggg
aatgcaagaacggccctgttcaactatttgtttgcacgaaatgccggaggaaagatggtt
atccgcattgaggatacagatgaaaagcgaaatgtagaaggcggagagcaaagtcagctt
aattatttacgctggcttggaattgattgggacgaaagcccggataagggtggggaatac
ggtccttatcgccaaatggagcgcctggatctttaccaaaaatatgtagatgatttgctt
gagcgcggcctggcatataaatgttatatgacagcagaagagctggaagcagaacgagaa
gcacaaattgcacgtggagaagcaccaaagtattcaggagctcatcgtgacttaagccaa
gagcagattgaacagtttgaggcagagggacgcgaaccaagtattcgcctgcgtgtaccg
gaaaaccatacgtacacgtttaacgatatcgtccgtgaaaacatcacgttcgaatccagt
gattttggggactgggttattgtaaagaaaagcggaacaccaacctacaactttgccgtt
gctgtagatgattaccttatggcgatcactcatgtactacgcggggaagagcacatctca
aacacacctaagcaaatgatggtatatgaagcgtttggatgggagccgcctaagtttggt
catatgacactcattctgaatgaaaatcgtaaaaagctaagcaagcgtgatgaacacatc
ctgcagttcattgagcaatataagaacttaggatatttacctgaatcattatttaatttt
attactttgcttggctggtcgccggtaggcgaagaggaaatcttcactcaggataaactg
attgaaatattcgatgcggaacgtctctctacttcaccagcggtttttgaccctgcaaaa
ctgaagtggatgaacaaccagtatattaaatcggctgagtttgatcgtgtagtagagtta
actctccctcatctcatcgaagcgggacgtgtttcagagaatatgagtgattccgaccgg
gagtgggtccatgaattaattgctctctaccaggaacaattggattatggcgcgcaaatt
gtggagcttacggaattattcttcaaacaagaaatacaatatgatgagagcgctatggaa
gtgctggaaggcgagcaagtgccagaagtgcttgatacgttcaagaaaaagctgaatgaa
ctggaagaattcacgccagaagcgatcaagaagcaggttaaagccgtacaaaaagaaacc
ggccataaagggaagaagcttttcatgccgattcgtgtagctacaaccggccaaacacac
ggtccagaactgcccaatgctattcacctgcttggtcttgaaaccgtcaatgtccgttta
gatgatgtattaaataaacttcaaggctaa

DBGET integrated database retrieval system