KEGG   Halobacillus halophilus: HBHAL_1176Help
Entry
HBHAL_1176        CDS       T02031                                 

Gene name
rocF
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hhd  Halobacillus halophilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hhd01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hhd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
176944..177846
Genome map
AA seq 300 aa AA seqDB search
MNKQISVIGVPMDLGQMRRGVDMGPSAIRYAGMTERLEKLKYDIEDLGDIDIPLPPKTGS
EKLDNLRNLNEISEGSQSLAKEVDKVVEEGRFPLVLGGDHSIAMGTLAGIAKHYENLGVI
WYDAHGDLNTADSSPSGNIHGMPLAVSLGIGHEKLTSIHGYEPKIKPENVVIVGARSLDE
GERELIKEHGIKVYTMHEVDRMGMTKVMEESVEYLKGRTDGVHLSLDLDGLDPHEAPGVG
TPVIGGLSYRESHLAMEMLYQSEMITSAEFVEVNPILDEKNKTASVAVGLMGSLFGESLK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaaatttccgttatcggggtaccaatggatttgggccaaatgagaagaggc
gtcgatatggggccgagcgcgattcgatatgcaggtatgacagagcgcttagaaaaatta
aaatatgatatagaagatttgggagatattgatattcctttacctccgaaaactggaagc
gagaaacttgataatttaagaaacttgaatgaaatttctgaaggaagccaaagtttagcc
aaagaagtagataaagttgtagaagaaggacgctttccgctggtactgggcggagatcac
agtatagctatgggaactttagctggcatagccaaacattatgagaatttaggagttatt
tggtatgacgcgcatggtgatttaaatacggctgatagttcaccttccggtaatattcat
ggtatgcctttagctgtaagcctgggaatcgggcatgagaagcttacaagtatccatggt
tatgaacctaaaattaagcctgaaaatgttgtcattgtgggggcgcgttcattagatgaa
ggtgagcgtgaactcattaaggaacatggaattaaagtttataccatgcacgaggtggac
cgtatgggcatgaccaaagtaatggaagaaagtgtagaatacttaaaagggcgtacggat
ggtgttcacttaagtcttgatctagatggattggatcctcacgaagcacctggagtcggt
acacctgtcattggtggactaagctatcgagaaagtcatttagctatggagatgctttat
cagtcggaaatgattacttctgcggagtttgtggaagttaacccgattttagatgaaaaa
aataagaccgcaagtgtcgcagtcggtttgatggggtctttatttggagaaagtttaaaa
taa

DBGET integrated database retrieval system