KEGG   Halobacillus halophilus: HBHAL_1310Help
Entry
HBHAL_1310        CDS       T02031                                 

Definition
NADPH--cytochrome P450 oxidoreductase (EC:1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
hhd  Halobacillus halophilus
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    HBHAL_1310
  Amino acid metabolism
   00380 Tryptophan metabolism
    HBHAL_1310
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HBHAL_1310
Enzymes [BR:hhd01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     HBHAL_1310
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     HBHAL_1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
309295..312462
Genome map
AA seq 1055 aa AA seqDB search
MEKTNHLPQPKSYGPLGNLPLINKEKPIQSFMKLADEFGPLYQFQFPGRTSRFVSSAQFA
AEICDESRFDKKVGPALQKVRAFGGDGLFTSETEEINWKKAHNILLPSFSQQAMKGYHNK
MVDLASQLIQKWARLNPNEEVEVPEDMTRLTLDTIGLCGFNYRFNSFYRERSHPFVEKMV
HALDESMSQTQRFELQDKLMIRTKKQYKEDIEYMFNLVDQLIAERKETGDQGEDDLLAHM
LKGKDPETGEALDDENIRFQIITFLIAGHETTSGLLSFAIHYLMKNPDKLKKAQEEVDEV
IGEDIPSYKQVKKLKYVRMILNEALRLWPTAPAFSVYAKENTTLAGQYEVEKGETFTLLL
PQLHRDTSIWGEDAEAFKPERFEDPSQIPRHAYKPFGNGQRACIGQQFALHEATLVLGMV
LQYFDFEDHTNYQLDVKEALTMKPEGLTMRVKSRRDAALMQPAPAQKEAEKSSKTEAQSV
PDAHLTPLLVLYGSNMGTAEGVARELAQTGKLQGFDVKTAPLNQYTSALPAEGAVLIVSA
SYNGNPPDNADAFVRWLKEADGEEAKGVSYAVFGCGDRNWASTYQRVPTLIDEELQALGA
ERILAREGGDASEDFEGDLEKWEAALWPALADTFNLELEEADDPSSHVSMEFVSGVTQTP
LARTHHAFTAMVNENRELQVSSERSTRHLELKLPEGVNYQEGDHLGVLPQNGTELVERVL
RRFQLKGEEYVVLGEDTGKATHLPTSQPISLRELLTSYVELQEPATRSQIRDLAAHNPCP
PHKMELEKLLEDETYKNEILAHRLTMLDLLEDYLSCEVPFERFLALLPPLKARYYSISSS
PRKHSEEASVTVSVVKDTAWSGRGEFKGTASNYMANRDIGDKVACFINTPQSNFTLPENP
ETPMVWIGPGTGIAPFRGFIQARENLLEEGHRLGEAHLYFGCRHPEKDFLYKNELEKAAD
KGLITLHTAFSRIEGKGKVYVQDRLWEDASTVLSLLENGGCLYICGDGSEMAPAVIEKII
KSYQHKYETTYEKAVEWLENLELEGRLAKDVWAGA
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaacaaaccatcttccgcagcctaaatcctatgggccactcggaaatttgccg
cttattaataaagaaaagcctattcagtcgtttatgaaactggctgatgaatttggtccg
ctctatcagttccaattccctggccgtaccagcagatttgtttcaagtgcacagtttgct
gctgagatttgtgatgaatcccgttttgataagaaggtcggtcctgctctgcaaaaggtc
cgtgcttttggaggagacggtttatttaccagtgaaacagaagaaatcaattggaaaaaa
gctcataatattttattgccaagctttagtcagcaggctatgaaaggctatcataataaa
atggttgatcttgcttctcagcttatccaaaaatgggctcgactaaatccgaatgaggaa
gttgaagttccggaagacatgacacgcttaacccttgatacaatagggttgtgcggtttt
aattaccggttcaacagcttttaccgggagaggtctcatccttttgttgaaaaaatggtg
catgcacttgatgaatctatgagtcaaacacagcgttttgagcttcaggataagctgatg
attcgtactaaaaaacagtacaaagaagacattgaatatatgttcaacttagtggatcag
ttaatagccgagcgtaaggaaacgggtgaccaaggggaagacgatctgcttgcccatatg
ttgaaagggaaagatcctgagactggagaagctctcgacgatgaaaatatccgcttccaa
atcattacttttttaattgccggccatgaaacgacgagtggtcttttatcttttgccatt
cattatttgatgaaaaatcctgataagttaaagaaagctcaggaagaagtagatgaagta
attggagaggatataccatcctataaacaagtgaaaaagctaaaatatgtacgaatgata
ttaaatgaggctttacggttatggcccacagctcctgctttttcagtttatgcgaaagaa
aatacgacacttgctggacagtatgaagtagaaaagggagagacgtttacactccttctt
cctcagctccacagggatactagcatatggggagaagatgctgaagccttcaagccagag
cgttttgaggatccttcccaaattccccgccatgcttacaaaccgtttgggaatggtcag
agagcgtgtataggacagcagttcgcgcttcatgaagctactcttgtacttgggatggtt
cttcagtattttgacttcgaagatcatacgaactatcagctggatgtcaaagaagcatta
acaatgaagccggaggggctgactatgcgtgtgaaatcaagacgcgatgcggctttaatg
cagccggcacctgctcagaaagaggcggaaaaatcgtctaaaacggaagcgcaaagcgtt
cctgatgctcacctcaccccgttacttgtattatatggttctaatatgggtacagcagaa
ggagtggctagagaacttgcgcagaccggaaagctccagggttttgatgtgaagaccgct
ccattaaatcagtacacatctgctctccctgcagaaggtgcggtgctgatagtgtcagca
tcctataatggaaacccgcctgataatgctgacgcttttgtccgctggcttaaggaagca
gatggagaagaagctaaaggagtaagctatgctgtgtttggatgtggagaccgaaactgg
gccagtacttatcagcgagtcccaacattgattgatgaggaacttcaagctcttggagca
gaacgtatccttgcacgagaaggcggagatgcgagtgaagatttcgaaggcgatttagaa
aaatgggaagcagcgttatggcctgcgctggcagatacgtttaatctggaacttgaagaa
gccgatgacccatccagtcatgtttcaatggagtttgtcagtggtgtcacacagacgcct
ctcgcccggactcatcatgcctttacagctatggtgaatgaaaatcgtgaattacaggtg
agcagtgaacgaagtactcggcatctggaattaaaacttcctgaaggagtgaattatcag
gagggggatcatcttggggttcttcctcaaaatggaacagagctcgtagaacgtgtcctt
cggcgctttcaattaaagggagaagagtatgtagttctaggcgaagatacaggaaaagca
acccatcttcctaccagtcagccgatcagcctaagagagctcctaacatcctatgttgaa
ttgcaagagccggctacccgaagccaaatcagggacttggctgctcacaacccttgcccg
ccgcacaaaatggagttggagaagcttcttgaggatgagacctacaaaaatgaaatactg
gctcatcgccttacgatgctggatcttcttgaagattatttgtcatgtgaagttcctttt
gaaagattcctagctctgcttccaccgcttaaagctcgttactattcaatttcgagctct
cctcgaaaacacagtgaggaggcgagtgttacggtaagtgtagtgaaagatacagcttgg
agcggaagaggagaattcaaaggaacagcatcgaattatatggctaaccgggacattggc
gataaggtggcttgttttattaacacacctcaatccaatttcaccctgcctgaaaatccg
gagactccgatggtgtggataggtccaggtacaggtattgctccattccgtgggtttatt
caagcacgtgagaacctgctcgaagagggtcatcgtcttggagaagcgcatttgtatttc
ggatgcagacacccggaaaaggacttcttatataagaacgagctggaaaaggcagcagat
aaaggacttattaccctgcatactgctttttcaagaatagaaggaaaagggaaagtttac
gttcaggatcgcctgtgggaagacgcctctaccgttctttcgctactggaaaacggaggc
tgcttgtacatttgtggtgacggcagtgagatggctcccgctgtcattgaaaaaattata
aaaagttaccaacacaaatacgagacgacatatgaaaaggcggttgaatggttagagaat
cttgaattagaaggacgtcttgctaaagatgtctgggctggtgcttaa

DBGET integrated database retrieval system