KEGG   Halobacillus halophilus: HBHAL_1426Help
Entry
HBHAL_1426        CDS       T02031                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
hhd  Halobacillus halophilus
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:hhd00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
432604..433935
Genome map
AA seq 443 aa AA seqDB search
MDAKLIQTIKGTNDRLAEKGMLPFKEKGTKEGPTLKITPGERYQTVMGFGGAFTEAAAYT
LAQISKEKRMEIIESYFHPVHGLAYSLGRTHIHSCDFSLGNYTYVEEDDEELRTFSIERE
HQYVIPFIKDAVKTRKEDLTILSSPWSPPAWMKTNNEMNNGGKLLPEYQSAWALYYSKYI
KAMEEAGIPIWGVTVQNEPDATQIWDSCRYTAEEERDFVRDYLGPTLEKEGLDHKKIVIW
DHNRDIAYERASTVLSDPEAAKYIWGTGIHWYVSEEFENLTKIHNDFPDKHIMFTEGCIE
GGVQLGAWHTGERYGRNIIGDLNNWLEGWIDWNLVLDEQGGPNHVGNYCDAPIIVDTKKE
QVHYNSSYYYIGHFSKYIKPNAVRIKHEIEHPALQVVAFQNEDDSIVVVVMNEKDEFAET
NLVLGDQACHVEFPSHSISTLVI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaaaattgatccaaacgataaaaggtacgaatgaccgtttagcagaaaaggga
atgctcccatttaaagaaaaaggtacaaaggaaggaccaactttaaagataacaccgggg
gaacgctatcagacagtaatggggtttgggggcgcttttaccgaagcggcagcttatacc
ttggcccaaatctccaaagagaaacgcatggaaatcatcgagagttactttcatcctgtg
catgggttagcttattcccttggaagaacacacattcatagctgcgacttttccctggga
aattacacgtatgtagaagaagatgatgaggaattacgcactttttccattgaaagagag
caccaatatgttattccatttattaaggatgccgtaaaaacaagaaaagaggatcttacc
attctttcctccccatggagtcctcctgcgtggatgaagacaaataatgaaatgaataat
ggtggaaagcttttaccagagtatcagagcgcttgggcactttattatagtaagtatata
aaggccatggaggaagcggggattcctatttggggagttacggttcaaaatgaaccagat
gccactcaaatttgggattcttgtcgttacacagcagaagaagagcgtgattttgtacgg
gattacttagggccaactctagaaaaagagggactggaccataaaaaaatcgtaatttgg
gaccacaatcgcgatattgcctatgagcgagcgagcacggttttgtctgaccctgaagcg
gctaaatatatctggggtacagggatccactggtatgttagtgaggaatttgaaaatcta
actaaaattcataatgattttccagataaacacattatgtttacagaaggatgtatagaa
ggtggcgttcagttaggagcttggcacacaggcgagcgatatggacgtaacattataggg
gatttgaataattggctggaagggtggatcgactggaatctggtcctggatgagcaaggt
gggccgaaccacgttgggaattattgtgatgctccaattattgtagatacaaagaaggaa
caagtgcactataatagctcgtattactatattggccactttagtaagtatattaagcca
aatgccgtaagaattaagcatgaaatcgagcatcctgcgttacaagtggttgcttttcaa
aatgaagatgattccatagttgtggtagtcatgaacgaaaaggatgaatttgcagaaaca
aacctggtgttaggagatcaagcctgtcatgtagagtttccatcccattccatttccacg
ttagtgatataa

DBGET integrated database retrieval system