KEGG   Halobacillus halophilus: HBHAL_1557Help
Entry
HBHAL_1557        CDS       T02031                                 

Gene name
phoB
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
hhd  Halobacillus halophilus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HBHAL_1557 (phoB)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HBHAL_1557 (phoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HBHAL_1557 (phoB)
Enzymes [BR:hhd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     HBHAL_1557 (phoB)
Exosome [BR:hhd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HBHAL_1557 (phoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(568920..570479)
Genome map
AA seq 519 aa AA seqDB search
MLKKSAAVLASSTMLFAGAAFGGGQEVHAGEHETSEVKNVIYMIPDGYSTSYATNYRWFK
GEDSAFDPYLKGMMKTYSEDSEVTDSAAAGTAMATGSKTNNGMVGVTPDGEEVESILDVS
EKAGKSSGLVATSTITHATPATFGSSVKDRDDQAKIAPQYLENDVDVIMGGGKEYFLPES
EGGKQKENNLVEQAQEDGYSYVENKEEMMDLKEDEKVLGLFAEGPMSSELDRDETDQPSL
SDMTSSAIDALSQDEDGFFLMVEGSQIDWAGHAHDAAWAMNDTQAFEKAVTEALEFAKQD
KNTLVVIAGDHDTGGMSVGANGEYDVKQDVVQEITATGDHMAEQLNDDKSNIKDVVNEYT
GLELSKEEVETIRSSETPNAAINQIVSDRALVGWTSSNHTGVDVPVYAFGPSSDQFSGLV
NNTDMPKKIAAAMGHKLDDEDGGHEGGMAWKEHDGIEYAVPMGGWHKGSVVDYLKSNGYK
ANFSFRGEIADSFDINNYQGTYDQNVFMLQTLKDEWHSK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaaaatctgctgctgtattggcaagttcgactatgttgttcgctggagctgct
tttggaggaggtcaagaggttcatgcgggagagcacgaaacttctgaagtaaagaacgtt
atttacatgattcccgatggctattcaacttcctatgccacgaactatcgatggtttaaa
ggggaagattctgctttcgatccttacttaaaaggaatgatgaaaacctattcggaggat
tctgaagtgaccgattcagccgcagctggaacggctatggctacagggtctaaaacgaac
aatggcatggttggcgtaactccagatggtgaagaagtggaaagtattcttgatgtatcc
gaaaaagcaggtaaatcatctggcctagtagctacctcaacaattacacatgctactccg
gctacatttggttcgtctgtaaaagatcgtgatgaccaggcgaaaattgctcctcagtac
ttagaaaatgatgtagacgtgatcatgggcggaggtaaagaatacttccttcctgaatct
gagggtggaaaacaaaaagaaaataacctcgttgaacaggctcaggaagacggttattct
tatgtggaaaataaagaggaaatgatggatcttaaggaagacgagaaagttcttggtctg
ttcgctgaaggtccaatgagctcagaactggatagagatgaaaccgatcagccaagtctt
tctgatatgacttcttctgctatcgacgctctttctcaagatgaagatggattctttctt
atggtagaaggcagtcaaattgactgggccggccatgctcacgatgctgcctgggctatg
aacgatactcaagcttttgaaaaagctgtaacagaagctttggaatttgctaaacaagat
aaaaatactttagttgtgattgcaggtgaccatgacacaggcggtatgagtgttggtgct
aacggtgaatatgatgtgaaacaagatgttgttcaggaaattacggctactggcgatcat
atggcggagcaattgaatgacgacaaatctaatattaaagatgtagttaacgaatatact
ggtttggagttgagcaaagaagaggttgaaaccatccgttcttcggaaactcctaacgcg
gcgatcaaccaaattgtcagtgaccgcgcgctcgtaggttggacaagttccaatcacact
ggagtagatgtacctgtttatgcattcggtccatcttctgatcagttttccggattggta
aacaatacggatatgccgaaaaaaatagcagctgccatgggtcataagctagatgacgaa
gacggaggccatgaaggtggaatggcttggaaagaacatgacggcatagaatatgcagtc
cctatgggtggatggcacaaaggaagtgtcgtagattacttaaaatccaacggatacaag
gcgaatttttccttccgcggtgaaattgcagacagctttgacataaacaattatcaaggc
acttacgatcagaatgtgtttatgctgcaaacgttaaaagatgaatggcacagtaaataa

DBGET integrated database retrieval system