KEGG   Halobacillus halophilus: HBHAL_1605Help
Entry
HBHAL_1605        CDS       T02031                                 

Gene name
thrC1
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00260  Glycine, serine and threonine metabolism
hhd00750  Vitamin B6 metabolism
hhd01100  Metabolic pathways
hhd01110  Biosynthesis of secondary metabolites
hhd01120  Microbial metabolism in diverse environments
hhd01230  Biosynthesis of amino acids
Module
hhd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HBHAL_1605 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HBHAL_1605 (thrC1)
Enzymes [BR:hhd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HBHAL_1605 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CCG43973
UniProt: I0JIK5
Position
618830..619933
Genome map
AA seq 367 aa AA seqDB search
MKAVFVDKWNNEYMPNRTDWKPKEGLFRLKPYPVKFPMKQIKDRQATMWRYQEALPFETI
DTYTSITMGEGMTPLVPLDADHPNLLMKMDYLMPTGSFKDRGAAVLIAKAKELGVSSVIA
DSSGNAGTAIAAYSARAGISCHIYVPDSTSEKKLAQIEAHGAHIHKIPGSREDTAEAAKQ
AVEKEKLYYASHVYNPFFYEGTKTFAFEIWEQLGEQVPDSLILPVGNGTLLLGAYIGFQN
LKEAGVIKSMPRIIGVQSEACAPIARAYTNGEPVSPAENRGTLAEGIAIADPMRGSEIIE
AVKDTKGTIVTAPEEGITSAGEELSGKGFYVEPTTAATYAAYKQHKAEMVPPDETVVMVL
CGSGLKK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtgtttgtggataagtggaacaatgaatatatgccgaatcgaacagactgg
aagccgaaagaaggtttattccggctgaagccgtatccggtgaaattcccaatgaagcag
attaaagataggcaggcaactatgtggcgctatcaggaagctttgccttttgagaccata
gatacatatacctctataaccatgggagaagggatgaccccgctcgtccctctggatgct
gatcatccaaaccttttgatgaaaatggactacctcatgccgacaggttcttttaaagac
cgcggagctgccgtgttaatcgcaaaagcgaaagaactcggcgtatcctctgtcattgcc
gacagcagtgggaatgccgggacagctattgccgcgtacagcgctagagccggtataagc
tgccatatctatgtgccagattccacttctgagaaaaaactcgctcagatcgaagcccac
ggagcccatatccataagattcccgggtcgcgtgaggatacggctgaggccgcaaaacaa
gcagtggagaaagaaaaactctattacgcaagtcacgtgtacaatccatttttctatgaa
ggtacgaaaacatttgcttttgaaatctgggagcagctgggggaacaggtgccggattcc
ctcattcttccggtcgggaatgggacacttctgctgggagcctatattggatttcagaat
ttaaaagaagccggcgttatcaaaagcatgccaagaataattggtgtccagtccgaggcc
tgtgcaccgattgcccgtgcttatacaaacggtgagcccgtgagtccggcagaaaacaga
ggcacgctggctgaagggattgccattgctgatcccatgcgcgggtcagagattatagaa
gcggttaaagatacgaagggcaccatcgtgacagcgcctgaggagggcataacgtctgca
ggagaggagctttccggaaaaggtttctatgtagagccgacaaccgccgctacgtatgcg
gcttataagcagcataaagcagaaatggtccctcccgatgaaacggttgtgatggtgctg
tgcggatcaggcttgaagaaatag

DBGET integrated database retrieval system