KEGG   Halobacillus halophilus: HBHAL_1605Help
Entry
HBHAL_1605        CDS       T02031                                 

Gene name
thrC1
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hhd  Halobacillus halophilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HBHAL_1605 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HBHAL_1605 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HBHAL_1605 (thrC1)
Enzymes [BR:hhd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HBHAL_1605 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
618830..619933
Genome map
AA seq 367 aa AA seqDB search
MKAVFVDKWNNEYMPNRTDWKPKEGLFRLKPYPVKFPMKQIKDRQATMWRYQEALPFETI
DTYTSITMGEGMTPLVPLDADHPNLLMKMDYLMPTGSFKDRGAAVLIAKAKELGVSSVIA
DSSGNAGTAIAAYSARAGISCHIYVPDSTSEKKLAQIEAHGAHIHKIPGSREDTAEAAKQ
AVEKEKLYYASHVYNPFFYEGTKTFAFEIWEQLGEQVPDSLILPVGNGTLLLGAYIGFQN
LKEAGVIKSMPRIIGVQSEACAPIARAYTNGEPVSPAENRGTLAEGIAIADPMRGSEIIE
AVKDTKGTIVTAPEEGITSAGEELSGKGFYVEPTTAATYAAYKQHKAEMVPPDETVVMVL
CGSGLKK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtgtttgtggataagtggaacaatgaatatatgccgaatcgaacagactgg
aagccgaaagaaggtttattccggctgaagccgtatccggtgaaattcccaatgaagcag
attaaagataggcaggcaactatgtggcgctatcaggaagctttgccttttgagaccata
gatacatatacctctataaccatgggagaagggatgaccccgctcgtccctctggatgct
gatcatccaaaccttttgatgaaaatggactacctcatgccgacaggttcttttaaagac
cgcggagctgccgtgttaatcgcaaaagcgaaagaactcggcgtatcctctgtcattgcc
gacagcagtgggaatgccgggacagctattgccgcgtacagcgctagagccggtataagc
tgccatatctatgtgccagattccacttctgagaaaaaactcgctcagatcgaagcccac
ggagcccatatccataagattcccgggtcgcgtgaggatacggctgaggccgcaaaacaa
gcagtggagaaagaaaaactctattacgcaagtcacgtgtacaatccatttttctatgaa
ggtacgaaaacatttgcttttgaaatctgggagcagctgggggaacaggtgccggattcc
ctcattcttccggtcgggaatgggacacttctgctgggagcctatattggatttcagaat
ttaaaagaagccggcgttatcaaaagcatgccaagaataattggtgtccagtccgaggcc
tgtgcaccgattgcccgtgcttatacaaacggtgagcccgtgagtccggcagaaaacaga
ggcacgctggctgaagggattgccattgctgatcccatgcgcgggtcagagattatagaa
gcggttaaagatacgaagggcaccatcgtgacagcgcctgaggagggcataacgtctgca
ggagaggagctttccggaaaaggtttctatgtagagccgacaaccgccgctacgtatgcg
gcttataagcagcataaagcagaaatggtccctcccgatgaaacggttgtgatggtgctg
tgcggatcaggcttgaagaaatag

DBGET integrated database retrieval system