KEGG   Halobacillus halophilus: HBHAL_1792Help
Entry
HBHAL_1792        CDS       T02031                                 

Gene name
proJ
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00330  Arginine and proline metabolism
hhd00332  Carbapenem biosynthesis
hhd01100  Metabolic pathways
hhd01130  Biosynthesis of antibiotics
hhd01230  Biosynthesis of amino acids
Module
hhd_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HBHAL_1792 (proJ)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    HBHAL_1792 (proJ)
Enzymes [BR:hhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     HBHAL_1792 (proJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA DUF2138
Motif
Other DBs
NCBI-ProteinID: CCG44156
UniProt: I0JJ38
Position
801570..802700
Genome map
AA seq 376 aa AA seqDB search
MLTQDKKRVVIKIGSSSLTSLHGEISRRKLEKLVDEVVQLKDDGHEVLLVSSGAVAAGYR
KLGCLERPSTLPEKQAAASIGQGLLMESYSDLFLSNGYIGSQILITRSDFSDEDRYNNAR
NTINVLLERGIIPIVNENDTITIDRLKFGDNDTLSAKVAGLVDADQLVILSDIDGLYDAD
PRKNEDAELLNKVHEITPEIEAAAGDPGSAVGTGGMKSKIDAFKISMASGISSFLGKAGT
DNIVYDAVYHNARGTYFETAPETENLDQKKQWIAFNSGPEGEVIIDHRAKESIVEMKRSL
LPMNVHHVKGRFKKGAVVRIHDLEGEEIGLGVVNYSSEQMKEMITLTEPELESYEKAAIE
RKDFVCHLDVALPAGV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgttgactcaagataaaaaaagggtagttataaaaataggaagcagttctttaaccagt
ttgcacggtgaaattagccgtcggaaactcgaaaaactagtagatgaagtcgtccaatta
aaggacgatggccacgaagtattactcgtatcctcgggtgcagtagcggcaggctaccgt
aagctcggatgcctggagcgtccaagcactttacctgaaaaacaagccgccgcctctatt
ggtcagggattactgatggaatcgtattccgatcttttcctgtctaatggttatattgga
tcccagatattaatcacacgcagtgatttttctgatgaagatcgttataacaacgctcgt
aatactattaacgtattgcttgaacgcggaatcatccccatcgtaaatgaaaatgacacc
atcaccatcgaccgtttgaaattcggtgataacgatacattgtccgctaaagtagctgga
cttgtcgatgctgatcaattagtgatcttatcggatatcgatggtttatatgatgcagat
cctagaaaaaatgaggatgctgaactactcaataaagtccacgaaatcaccccagagatt
gaagcagcagctggcgacccaggaagcgccgtcggtacagggggcatgaaatccaaaata
gacgcctttaagatttctatggcttccggtatatcttccttcttaggaaaagcaggtacc
gacaacattgtttatgatgctgtctaccacaacgcaagaggaacctatttcgaaaccgca
ccggaaaccgagaatctcgaccagaagaaacaatggattgcttttaactccggtcctgaa
ggcgaagtcattattgaccatcgcgctaaagaatctattgtagaaatgaagagaagcttg
cttcctatgaatgtgcaccacgtaaaaggacgtttcaaaaaaggtgccgttgtgcgtatt
catgatttagaaggcgaagagattggtctgggcgtagtgaattattcctcagagcaaatg
aaggaaatgattactctaacagaacctgaactcgaatcttatgaaaaagcagcgattgaa
cgtaaagattttgtctgccatttagacgtagccctgcccgcaggcgtttaa

DBGET integrated database retrieval system