KEGG   Halobacillus halophilus: HBHAL_1873Help
Entry
HBHAL_1873        CDS       T02031                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00010  Glycolysis / Gluconeogenesis
hhd00620  Pyruvate metabolism
hhd00640  Propanoate metabolism
hhd00680  Methane metabolism
hhd01100  Metabolic pathways
hhd01110  Biosynthesis of secondary metabolites
hhd01120  Microbial metabolism in diverse environments
hhd01130  Biosynthesis of antibiotics
hhd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBHAL_1873
   00620 Pyruvate metabolism
    HBHAL_1873
   00640 Propanoate metabolism
    HBHAL_1873
  Energy metabolism
   00680 Methane metabolism
    HBHAL_1873
Enzymes [BR:hhd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HBHAL_1873
Lipid biosynthesis proteins [BR:hhd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HBHAL_1873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CCG44235
UniProt: I0JJB7
Position
875248..876822
Genome map
AA seq 524 aa AA seqDB search
MDREELIAPERYNVVSEMEKFAEDPDRKALLWLSEAGGRKEVTYEQLLHQANKMGNAFLD
HGLQKGDKILVMIPRLIEAYQVYIAALKAGLVIIPSSEMLRAKDLQYRITHGDVRAVVSY
HPFTEHLDEVKESEQLLKFSVGGSKEGWFDFDGLLEDYSSTLETADTASDDMAFLSYTSG
TTGNPKGVVHTHGWGYAHLKTAAYKWLAIQDGDTVWATAGPGWQKWVWSPFLSVLGTGAR
GLVYQGKFNPKTYLSLMDEHNVNVLCCTPTEYRLMAKVDNLDDYKLAGLHSAVSAGEPLN
REVIDTFKNHFNVTVRDGYGQTENTLLVGILKDMEVRPGSMGRPTPGNQVEIIDELAEPV
ETGEVGDIAVHLDTPALFKEYYKDPERTKMSHRGHYYVTGDQARKDEDGYFWFEGRSDDI
IISSGYTIGPFEVEDALVKHKAVQECAVVSSPDEVRGNVVKAFIVLQNNYEPTDNLVKEL
QDHVKNTTAPYKYPRKIEFTEELPKTTSGKIRRVELRKKENASR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtggatcgtgaagaattaattgcccctgaaagatataacgtagtttcagagatggagaag
ttcgcggaagatcctgaccgaaaggctttattgtggctgagtgaagcaggtggccgaaaa
gaagttacatatgaacagctgctgcatcaggcaaacaagatgggaaatgcttttctggac
catggtttgcaaaagggagataaaatccttgtcatgattcctcgattgattgaagcgtat
caagtatatatagctgctttaaaagctggattagttattattccaagttcagaaatgctg
cgtgcgaaagacctgcagtaccggattactcatggggatgtacgtgcggtcgtcagttac
catccctttacagaacacttggatgaagtgaaagaaagtgaacaactccttaaattttct
gtaggaggttcgaaagaaggctggtttgactttgacggattattagaggattacagttct
actcttgaaacagctgacacagctagcgacgatatggcctttttatcgtacacttctgga
acgacaggcaatccaaaaggagtggttcatacccatggatggggatacgctcatttgaag
actgctgcttataagtggcttgctattcaagatggtgatacagtatgggcgacagctggg
ccaggctggcagaagtgggtgtggagcccgtttttatccgtcctgggtacgggtgcaaga
ggtctcgtgtatcaagggaaattcaatccgaaaacctatttaagccttatggatgagcac
aatgttaacgttttatgctgtacaccaactgaataccgcctgatggctaaagtagataat
cttgatgattataagcttgctggactgcacagcgctgtttctgcaggtgaaccactaaac
agggaagttattgatacttttaagaatcatttcaatgtaacggttagggatggttatggt
cagacagagaatactcttttagtaggaattttgaaagacatggaggtccgtcctggttcc
atgggacgtcctacaccagggaatcaagttgaaattattgatgaacttgctgaacctgtg
gaaacgggagaagttggagatatcgctgtgcatctggatactcctgctttgttcaaagag
tattataaggatccggaacgcacaaaaatgtctcatcgtggacattattatgtgacaggg
gaccaggcgagaaaagatgaagatgggtatttctggtttgaaggtcgcagtgatgatatt
attatcagttccggttacaccattggaccttttgaagtagaagatgctctcgtgaagcac
aaagctgtgcaggagtgtgctgtagtttcaagccctgatgaggttcgtggtaatgttgtt
aaagcttttattgtacttcagaacaactatgagccaacagataatctagtaaaagaatta
caggaccatgttaagaacaccacggcaccttataaatatccgagaaaaatcgagttcacc
gaagaacttcctaaaacgacgtccggaaaaatacgtcgcgtagagcttcgtaaaaaagaa
aatgcttccagatag

DBGET integrated database retrieval system